Homologs in group_1891

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14125 FBDBKF_14125 70.1 Morganella morganii S1 nuoJ NADH-quinone oxidoreductase subunit J
EHELCC_08155 EHELCC_08155 70.1 Morganella morganii S2 nuoJ NADH-quinone oxidoreductase subunit J
NLDBIP_08480 NLDBIP_08480 70.1 Morganella morganii S4 nuoJ NADH-quinone oxidoreductase subunit J
LHKJJB_05785 LHKJJB_05785 70.1 Morganella morganii S3 nuoJ NADH-quinone oxidoreductase subunit J
HKOGLL_05130 HKOGLL_05130 70.1 Morganella morganii S5 nuoJ NADH-quinone oxidoreductase subunit J
F4V73_RS02810 F4V73_RS02810 69.5 Morganella psychrotolerans nuoJ NADH-quinone oxidoreductase subunit J

Distribution of the homologs in the orthogroup group_1891

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1891

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFE3 3.69e-85 251 71 0 177 3 nuoJ NADH-quinone oxidoreductase subunit J Shigella flexneri
P0AFE0 3.69e-85 251 71 0 177 1 nuoJ NADH-quinone oxidoreductase subunit J Escherichia coli (strain K12)
P0AFE1 3.69e-85 251 71 0 177 3 nuoJ NADH-quinone oxidoreductase subunit J Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFE2 3.69e-85 251 71 0 177 3 nuoJ NADH-quinone oxidoreductase subunit J Escherichia coli O157:H7
Q9I0J3 1.13e-57 181 65 1 166 3 nuoJ NADH-quinone oxidoreductase subunit J Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57260 1.84e-45 150 53 0 165 3 nuoJ NADH-quinone oxidoreductase subunit J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AT8 2.16e-36 127 45 1 161 3 nuoJ NADH-quinone oxidoreductase subunit J Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K9X9 3.76e-31 113 57 0 163 3 nuoJ NADH-quinone oxidoreductase subunit J Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O63849 8.87e-13 66 30 5 165 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Sarcophyton glaucum
P50975 9.76e-13 66 47 0 74 3 nuoJ NADH-quinone oxidoreductase subunit J Rhodobacter capsulatus
Q68VV9 1.66e-11 63 27 5 185 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCG3 5.55e-11 62 27 5 177 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia prowazekii (strain Madrid E)
Q4UK29 9.31e-10 58 26 4 175 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P48924 3.87e-09 57 44 0 74 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Chondrus crispus
B3TNA2 4.64e-09 56 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Brachypodium distachyon
Q1RKE8 5.57e-09 56 28 2 158 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia bellii (strain RML369-C)
Q6YXQ0 5.98e-09 56 29 4 185 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Physcomitrium patens
Q49KU5 7.2e-09 55 28 4 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Eucalyptus globulus subsp. globulus
Q95H44 9.19e-09 55 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Triticum aestivum
A1EA62 9.19e-09 55 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Agrostis stolonifera
Q06R77 9.77e-09 55 31 6 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Jasminum nudiflorum
Q37371 1.4e-08 55 41 0 70 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Acanthamoeba castellanii
Q37626 1.87e-08 55 36 0 90 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Prototheca wickerhamii
O47498 2.03e-08 55 40 0 72 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Metridium senile
A8Y9E0 2.2e-08 54 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lolium perenne
O98693 2.49e-08 54 27 3 153 1 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Hordeum vulgare
A9L9F0 2.5e-08 54 29 3 154 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lemna minor
A4QJQ3 2.52e-08 54 26 2 162 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Aethionema grandiflorum
Q8S8U6 2.73e-08 54 31 6 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Atropa belladonna
B0Z5I0 2.9e-08 53 30 6 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera parviflora
B0Z596 2.9e-08 53 30 6 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera glazioviana
Q9MTH9 2.9e-08 53 30 6 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera elata subsp. hookeri
B0Z512 2.9e-08 53 30 6 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera biennis
B0Z4S8 2.9e-08 53 30 6 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera argillicola
Q2MI47 3.48e-08 53 31 6 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Solanum lycopersicum
Q2PMN5 4.18e-08 53 29 5 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Glycine max
Q27RZ6 5.02e-08 53 31 6 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Solanum tuberosum
Q92G99 6.2e-08 53 25 2 160 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9BBP1 7.3e-08 53 28 5 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lotus japonicus
Q32722 7.75e-08 52 31 6 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nicotiana tabacum
Q33BW9 7.75e-08 52 31 6 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nicotiana tomentosiformis
Q3C1Q1 7.75e-08 52 31 6 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nicotiana sylvestris
Q7YJT1 8.32e-08 52 28 4 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Calycanthus floridus var. glaucus
Q9M3I8 8.41e-08 52 28 5 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Spinacia oleracea
A1XGT8 1.06e-07 52 27 4 174 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Ranunculus macranthus
Q2MID4 1.13e-07 52 30 6 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Solanum bulbocastanum
A6MMH4 1.64e-07 52 30 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Chloranthus spicatus
B1X496 1.82e-07 52 29 5 182 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, organellar chromatophore Paulinella chromatophora
Q0G9G6 1.83e-07 52 29 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Liriodendron tulipifera
A7Y3L7 1.89e-07 52 30 4 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Ipomoea purpurea
P06266 2.27e-07 52 29 7 185 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Marchantia polymorpha
A0A388 2.53e-07 51 29 6 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Coffea arabica
A4QJG9 2.85e-07 51 25 2 162 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Aethionema cordifolium
Q2L958 2.88e-07 51 29 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Gossypium hirsutum
Q85CT7 3.02e-07 51 29 6 189 2 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Anthoceros angustus
Q09FZ3 3.22e-07 51 28 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Platanus occidentalis
Q09FQ7 3.53e-07 51 29 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nandina domestica
Q09WW5 6.58e-07 50 27 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Morus indica
Q3V4Y1 6.93e-07 50 28 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Acorus calamus
A9LYF3 6.93e-07 50 28 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Acorus calamus var. americanus
A4GGE9 7.72e-07 50 27 4 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Phaseolus vulgaris
Q09MC3 7.84e-07 50 27 4 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Citrus sinensis
P26523 7.85e-07 50 27 2 173 3 ndhG NAD(P)H-quinone oxidoreductase chain 6 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A6MMZ8 1.11e-06 49 29 5 154 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Illicium oligandrum
A8SEF8 1.26e-06 49 28 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Ceratophyllum demersum
Q56225 1.5e-06 49 50 0 52 1 nqo10 NADH-quinone oxidoreductase subunit 10 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P29922 1.57e-06 49 30 2 179 3 nqo10 NADH-quinone oxidoreductase chain 10 Paracoccus denitrificans
Q0ZIW5 1.7e-06 49 26 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Vitis vinifera
P0C331 1.7e-06 49 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza sativa subsp. japonica
P0C330 1.7e-06 49 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza sativa subsp. indica
P0C329 1.7e-06 49 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza sativa
Q6ENA4 1.7e-06 49 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza nivara
Q6EVZ7 1.8e-06 49 26 4 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nymphaea alba
B1NWK2 2.04e-06 48 27 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Manihot esculenta
A9QC80 2.06e-06 48 27 5 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Trachelium caeruleum
Q68RV3 2.37e-06 48 28 5 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Panax ginseng
Q0G9Q9 3.3e-06 48 27 5 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Daucus carota
Q06GU3 3.98e-06 48 28 5 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Drimys granadensis
A6H5P5 4.01e-06 48 27 3 158 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Cycas taitungensis
P26850 5.35e-06 48 40 0 72 2 ND6 NADH-ubiquinone oxidoreductase chain 6 Marchantia polymorpha
Q0H8W8 6e-06 48 44 0 65 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Ustilago maydis (strain 521 / FGSC 9021)
Q70XW1 6e-06 47 28 5 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Amborella trichopoda
A4QLY8 6.49e-06 47 26 2 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nasturtium officinale
Q06FQ1 7.32e-06 47 26 4 157 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Pelargonium hortorum
A4GYW9 7.61e-06 47 28 6 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Populus trichocarpa
Q14FA5 7.61e-06 47 28 6 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Populus alba
Q00243 8e-06 47 29 6 147 3 ndhG NAD(P)H-quinone oxidoreductase chain 6 Leptolyngbya boryana
Q95695 9.11e-06 47 27 2 151 1 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Arabidopsis thaliana
A6MM90 9.48e-06 47 28 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Buxus microphylla
A4QKY7 1.05e-05 47 26 2 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Crucihimalaya wallichii
A4QLQ0 1.08e-05 47 26 2 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lobularia maritima
A0ZZ88 1.18e-05 47 28 4 146 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Gossypium barbadense
Q06GK8 1.29e-05 47 28 5 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Piper cenocladum
A1XG08 1.44e-05 46 26 4 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nuphar advena
A4QKP8 1.47e-05 46 27 2 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Capsella bursa-pastoris
B1A987 1.6e-05 46 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Carica papaya
A4QJY5 2.16e-05 46 26 2 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Olimarabidopsis pumila
A4QKG0 2.48e-05 45 26 2 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Barbarea verna
A4QL74 3.11e-05 45 26 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Draba nemorosa
A4QK73 3.54e-05 45 26 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Arabis hirsuta
Q332S4 3.83e-05 45 25 4 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lactuca sativa
A1E9X7 3.95e-05 45 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Sorghum bicolor
Q6ENP4 3.95e-05 45 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Saccharum officinarum
Q6L3D7 3.95e-05 45 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Saccharum hybrid
P46621 3.95e-05 45 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Zea mays
A4QLG2 4.53e-05 45 26 2 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lepidium virginicum
B2LMP5 5.1e-05 45 25 4 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Guizotia abyssinica
P15959 9.2e-05 44 35 1 87 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
B5LMS3 0.000123 43 25 4 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Cicer arietinum
Q02500 0.000136 44 32 2 93 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Triticum aestivum
P48925 0.000151 43 33 2 114 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Cyanidium caldarium
Q1KXQ6 0.000158 43 24 4 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Helianthus annuus
P0CY45 0.000283 43 32 0 80 3 ndh-6 NADH-ubiquinone oxidoreductase chain 6 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P60497 0.000285 43 35 0 74 1 ND6 NADH-ubiquinone oxidoreductase chain 6 Arabidopsis thaliana
B1VKI7 0.000292 43 27 4 158 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Cryptomeria japonica
Q2QD38 0.000324 42 25 5 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Cucumis sativus
Q37314 0.000854 42 31 0 72 3 nad6 NADH-ubiquinone oxidoreductase chain 6 Dictyostelium discoideum

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08605
Feature type CDS
Gene nuoJ
Product NADH-quinone oxidoreductase subunit J
Location 1878849 - 1879382 (strand: -1)
Length 534 (nucleotides) / 177 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1891
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00499 NADH-ubiquinone/plastoquinone oxidoreductase chain 6

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0839 Energy production and conversion (C) C NADH:ubiquinone oxidoreductase subunit 6 (chain J)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00339 NADH-quinone oxidoreductase subunit J [EC:7.1.1.2] Oxidative phosphorylation
Metabolic pathways		 NADH:quinone oxidoreductase, prokaryotes

Protein Sequence

MEFAFYIAGLISILATLRVITHTNPVHALLYLIVSLIGLSVVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGKSVVEQERKWLQPRFWIGPAILSLVLLIVLVYAISSVTHGEISGEIIGAKEVGISLFGPYILAVELASVLLLSGLIVAYHIGRDQSHDDLVENEKVGEPK

Flanking regions ( +/- flanking 50bp)

AAGCGAAACCTATCGATGTCAAAAGCCTGTTACCGTAAGGAGCGATATTCATGGAATTTGCATTCTATATTGCAGGACTGATTTCAATCCTTGCCACTTTGAGAGTAATAACGCATACCAATCCGGTACACGCACTGCTGTATCTGATTGTTTCATTAATTGGCCTTTCAGTGGTGTTCTTCTCGTTAGGTGCCTATTTTGCAGGTGCTTTAGAGATCATCGTTTACGCCGGCGCGATTATGGTGCTATTCGTATTCGTTGTGATGATGCTTAACTTAGGAAAATCGGTCGTTGAGCAAGAGAGAAAATGGTTACAGCCTAGATTTTGGATAGGGCCGGCGATTTTGTCTCTGGTACTGTTAATTGTATTGGTTTATGCAATTAGTAGTGTCACTCATGGTGAGATTAGTGGCGAGATTATTGGGGCGAAAGAAGTCGGTATTAGCTTATTTGGGCCTTATATTCTGGCTGTTGAGTTAGCCTCCGTTCTCTTATTGTCAGGATTAATTGTTGCTTATCACATCGGTCGTGATCAGAGCCATGACGATCTCGTCGAAAACGAAAAAGTAGGGGAGCCAAAATGATACCTCTTCAACATGGTTTGATCTTGGCTGCGGTACTATTTGTGTTAGGT