Homologs in group_1891

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14125 FBDBKF_14125 100.0 Morganella morganii S1 nuoJ NADH-quinone oxidoreductase subunit J
NLDBIP_08480 NLDBIP_08480 100.0 Morganella morganii S4 nuoJ NADH-quinone oxidoreductase subunit J
LHKJJB_05785 LHKJJB_05785 100.0 Morganella morganii S3 nuoJ NADH-quinone oxidoreductase subunit J
HKOGLL_05130 HKOGLL_05130 100.0 Morganella morganii S5 nuoJ NADH-quinone oxidoreductase subunit J
F4V73_RS02810 F4V73_RS02810 97.8 Morganella psychrotolerans nuoJ NADH-quinone oxidoreductase subunit J
PMI_RS08605 PMI_RS08605 70.1 Proteus mirabilis HI4320 nuoJ NADH-quinone oxidoreductase subunit J

Distribution of the homologs in the orthogroup group_1891

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1891

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFE3 6.68e-84 248 68 1 184 3 nuoJ NADH-quinone oxidoreductase subunit J Shigella flexneri
P0AFE0 6.68e-84 248 68 1 184 1 nuoJ NADH-quinone oxidoreductase subunit J Escherichia coli (strain K12)
P0AFE1 6.68e-84 248 68 1 184 3 nuoJ NADH-quinone oxidoreductase subunit J Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFE2 6.68e-84 248 68 1 184 3 nuoJ NADH-quinone oxidoreductase subunit J Escherichia coli O157:H7
Q9I0J3 7.1e-56 176 66 1 163 3 nuoJ NADH-quinone oxidoreductase subunit J Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57260 1.09e-44 148 51 0 169 3 nuoJ NADH-quinone oxidoreductase subunit J Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AT8 7.93e-35 123 41 1 164 3 nuoJ NADH-quinone oxidoreductase subunit J Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K9X9 7.43e-31 112 55 0 163 3 nuoJ NADH-quinone oxidoreductase subunit J Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9ZCG3 1.13e-15 74 29 3 179 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia prowazekii (strain Madrid E)
Q1RKE8 1.27e-14 71 29 4 182 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia bellii (strain RML369-C)
Q68VV9 1.52e-14 71 27 3 184 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P50975 3.24e-13 67 32 4 159 3 nuoJ NADH-quinone oxidoreductase subunit J Rhodobacter capsulatus
Q4UK29 6.73e-13 67 26 3 179 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92G99 7.16e-13 67 26 4 187 3 nuoJ NADH-quinone oxidoreductase subunit J Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q06R77 1.39e-09 57 30 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Jasminum nudiflorum
O63849 2.01e-09 57 26 1 150 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Sarcophyton glaucum
P48924 2.36e-09 57 45 0 72 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Chondrus crispus
Q9BBP1 4.59e-09 56 28 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lotus japonicus
Q37371 4.9e-09 57 40 1 84 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Acanthamoeba castellanii
B3TNA2 6.17e-09 55 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Brachypodium distachyon
A0A388 8.13e-09 55 28 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Coffea arabica
A8Y9E0 9.67e-09 55 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lolium perenne
Q95H44 1.13e-08 55 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Triticum aestivum
A1EA62 1.13e-08 55 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Agrostis stolonifera
O47498 1.15e-08 55 45 0 60 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Metridium senile
A9L9F0 1.18e-08 55 28 3 154 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lemna minor
A7Y3L7 1.58e-08 54 29 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Ipomoea purpurea
O98693 3.18e-08 53 27 3 153 1 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Hordeum vulgare
A6MMH4 5.01e-08 53 28 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Chloranthus spicatus
A4QJQ3 5.72e-08 53 27 3 156 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Aethionema grandiflorum
Q56225 5.78e-08 53 53 0 52 1 nqo10 NADH-quinone oxidoreductase subunit 10 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q2MI47 6.46e-08 53 28 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Solanum lycopersicum
A6MMZ8 6.61e-08 53 29 3 154 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Illicium oligandrum
Q70XW1 1.19e-07 52 28 3 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Amborella trichopoda
Q27RZ6 1.22e-07 52 27 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Solanum tuberosum
Q49KU5 1.28e-07 52 26 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Eucalyptus globulus subsp. globulus
Q6EVZ7 1.42e-07 52 29 5 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nymphaea alba
A4QJG9 1.49e-07 52 26 3 162 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Aethionema cordifolium
Q8S8U6 1.52e-07 52 27 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Atropa belladonna
Q7YJT1 1.56e-07 52 29 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Calycanthus floridus var. glaucus
Q32722 1.57e-07 52 27 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nicotiana tabacum
Q33BW9 1.57e-07 52 27 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nicotiana tomentosiformis
Q3C1Q1 1.57e-07 52 27 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nicotiana sylvestris
Q0H8W8 1.62e-07 52 46 0 65 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Ustilago maydis (strain 521 / FGSC 9021)
B0Z5I0 1.83e-07 52 29 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera parviflora
B0Z596 1.83e-07 52 29 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera glazioviana
Q9MTH9 1.83e-07 52 29 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera elata subsp. hookeri
B0Z512 1.83e-07 52 29 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera biennis
B0Z4S8 1.83e-07 52 29 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oenothera argillicola
Q2PMN5 1.87e-07 52 27 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Glycine max
Q2MID4 2.08e-07 51 27 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Solanum bulbocastanum
P26850 2.17e-07 52 43 0 74 2 ND6 NADH-ubiquinone oxidoreductase chain 6 Marchantia polymorpha
P29922 2.73e-07 51 31 4 183 3 nqo10 NADH-quinone oxidoreductase chain 10 Paracoccus denitrificans
A1XG08 3.16e-07 51 29 5 164 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nuphar advena
Q09FZ3 3.41e-07 51 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Platanus occidentalis
Q09FQ7 3.52e-07 51 27 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nandina domestica
A1XGT8 3.75e-07 51 28 3 167 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Ranunculus macranthus
P26523 4.45e-07 51 29 6 179 3 ndhG NAD(P)H-quinone oxidoreductase chain 6 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0G9G6 4.57e-07 50 27 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Liriodendron tulipifera
Q09WW5 5.42e-07 50 28 5 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Morus indica
Q6YXQ0 5.7e-07 50 27 2 176 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Physcomitrium patens
Q37626 6.41e-07 50 34 0 90 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Prototheca wickerhamii
A4GGE9 6.76e-07 50 27 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Phaseolus vulgaris
Q09MC3 6.86e-07 50 27 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Citrus sinensis
Q3V4Y1 7.27e-07 50 27 4 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Acorus calamus
A9LYF3 7.27e-07 50 27 4 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Acorus calamus var. americanus
Q0G9Q9 8.43e-07 50 27 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Daucus carota
Q2L958 1.06e-06 49 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Gossypium hirsutum
B1NWK2 1.81e-06 49 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Manihot esculenta
P06266 1.82e-06 49 25 3 175 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Marchantia polymorpha
Q68RV3 1.94e-06 49 27 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Panax ginseng
A4QLQ0 1.98e-06 48 27 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lobularia maritima
P0C331 2.08e-06 48 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza sativa subsp. japonica
P0C330 2.08e-06 48 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza sativa subsp. indica
P0C329 2.08e-06 48 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza sativa
Q6ENA4 2.08e-06 48 26 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Oryza nivara
Q0ZIW5 2.77e-06 48 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Vitis vinifera
Q06GK8 3.1e-06 48 26 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Piper cenocladum
A4QLY8 3.1e-06 48 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nasturtium officinale
P0CY45 3.25e-06 49 39 1 73 3 ndh-6 NADH-ubiquinone oxidoreductase chain 6 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q95695 3.6e-06 48 26 3 152 1 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Arabidopsis thaliana
A6H5P5 3.62e-06 48 30 4 159 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Cycas taitungensis
Q02500 4.03e-06 48 36 0 73 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Triticum aestivum
A4QKP8 4.3e-06 48 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Capsella bursa-pastoris
Q06GU3 4.35e-06 48 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Drimys granadensis
A9QC80 4.8e-06 48 26 3 156 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Trachelium caeruleum
A6MM90 4.95e-06 48 26 3 156 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Buxus microphylla
Q332S4 5.57e-06 47 25 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lactuca sativa
B1X496 5.67e-06 48 27 5 183 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, organellar chromatophore Paulinella chromatophora
B2LMP5 6.28e-06 47 25 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Guizotia abyssinica
Q37314 6.93e-06 48 25 7 203 3 nad6 NADH-ubiquinone oxidoreductase chain 6 Dictyostelium discoideum
A4QLG2 8.47e-06 47 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Lepidium virginicum
Q9M3I8 8.55e-06 47 26 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Spinacia oleracea
A4QKY7 8.9e-06 47 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Crucihimalaya wallichii
A8SEF8 8.9e-06 47 27 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Ceratophyllum demersum
A4QJY5 9.54e-06 47 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Olimarabidopsis pumila
Q85CT7 1.19e-05 47 29 3 173 2 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Anthoceros angustus
B1A987 1.23e-05 47 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Carica papaya
A4QKG0 1.27e-05 47 26 3 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Barbarea verna
B5LMS3 1.46e-05 46 25 3 156 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Cicer arietinum
A0ZZ88 1.57e-05 46 27 4 147 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Gossypium barbadense
A4QL74 1.76e-05 46 26 4 152 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Draba nemorosa
Q1KXQ6 1.8e-05 46 25 3 151 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Helianthus annuus
Q06FQ1 3.74e-05 45 28 5 157 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Pelargonium hortorum
Q9TKV3 4.15e-05 45 31 3 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Nephroselmis olivacea
P60497 4.29e-05 45 37 0 74 1 ND6 NADH-ubiquinone oxidoreductase chain 6 Arabidopsis thaliana
A4QK73 5.89e-05 45 26 3 163 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Arabis hirsuta
Q00243 7.95e-05 44 27 5 165 3 ndhG NAD(P)H-quinone oxidoreductase chain 6 Leptolyngbya boryana
Q2LCR2 0.000201 43 27 2 93 3 nad6 NADH-ubiquinone oxidoreductase chain 6 Dictyostelium citrinum
A1E9X7 0.00026 43 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Sorghum bicolor
Q6ENP4 0.00026 43 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Saccharum officinarum
Q6L3D7 0.00026 43 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Saccharum hybrid
P46621 0.00026 43 33 1 65 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Zea mays
A4GYW9 0.000289 43 27 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Populus trichocarpa
Q14FA5 0.000289 43 27 5 153 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Populus alba
P48925 0.000366 43 40 0 75 3 ND6 NADH-ubiquinone oxidoreductase chain 6 Cyanidium caldarium
B1VKI7 0.00041 42 26 4 157 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Cryptomeria japonica
A6MMR0 0.000767 42 25 2 120 3 ndhG NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic Dioscorea elephantipes
Q9B6E9 0.000842 42 30 1 82 1 ND6 NADH-ubiquinone oxidoreductase chain 6 Yarrowia lipolytica (strain CLIB 122 / E 150)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_08155
Feature type CDS
Gene nuoJ
Product NADH-quinone oxidoreductase subunit J
Location 96592 - 97128 (strand: 1)
Length 537 (nucleotides) / 178 (amino acids)

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1891
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00499 NADH-ubiquinone/plastoquinone oxidoreductase chain 6

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0839 Energy production and conversion (C) C NADH:ubiquinone oxidoreductase subunit 6 (chain J)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00339 NADH-quinone oxidoreductase subunit J [EC:7.1.1.2] Oxidative phosphorylation
Metabolic pathways		 NADH:quinone oxidoreductase, prokaryotes

Protein Sequence

MEITFYVAGLIAILATLCVITQTNPVHALLYLITSLLALSAVFFALGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGRAVVDQERKWLSPSVWMGPGLLSAVLLGVMIYGISSLKDNGIAGEVVTAKQVGISLFGPYVLVVELASFLLLAGLVVAYHIGRDEKAGGDIVSQRNTEEKA

Flanking regions ( +/- flanking 50bp)

AGCCAGGCCGATTGATGTGAAAAGTCTGCTGCCATAAGGGGAGAAAATACATGGAAATTACCTTTTATGTCGCCGGACTGATCGCCATTCTGGCTACGCTGTGTGTGATCACACAGACCAATCCGGTGCATGCGCTGCTGTATCTGATCACCTCGCTGCTGGCACTCTCTGCGGTCTTCTTTGCTCTCGGCGCCTATTTCGCCGGGGCACTGGAGATTATCGTCTACGCAGGTGCCATCATGGTGCTGTTCGTGTTTGTGGTGATGATGCTCAACCTCGGGCGGGCGGTTGTCGACCAGGAACGCAAATGGCTGTCCCCGTCTGTCTGGATGGGGCCGGGCCTGCTTTCGGCGGTTCTGCTCGGCGTGATGATTTACGGTATCAGCTCTCTGAAAGATAACGGTATCGCCGGTGAGGTGGTTACCGCGAAACAGGTGGGTATCAGTCTGTTCGGCCCGTATGTTCTGGTGGTTGAACTGGCCTCCTTCCTGCTGCTGGCGGGTCTGGTGGTGGCATACCACATCGGGCGTGACGAAAAAGCGGGCGGCGATATTGTCAGTCAGCGCAACACGGAGGAAAAAGCATGATCCCTCTGCACCACGGATTAATTCTCGCGGCTGTGCTCTTCATCCTCGGT