Homologs in group_1883

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14080 FBDBKF_14080 51.0 Morganella morganii S1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
EHELCC_08200 EHELCC_08200 51.0 Morganella morganii S2 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
NLDBIP_08525 NLDBIP_08525 51.0 Morganella morganii S4 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
LHKJJB_05740 LHKJJB_05740 51.0 Morganella morganii S3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
HKOGLL_05175 HKOGLL_05175 51.0 Morganella morganii S5 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
F4V73_RS02855 F4V73_RS02855 50.6 Morganella psychrotolerans menH 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

Distribution of the homologs in the orthogroup group_1883

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1883

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N2K4 1.96e-108 317 60 0 254 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7FGT3 3.71e-96 285 54 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1CHT0 4.77e-96 285 54 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A4TM07 1.89e-95 284 54 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis (strain Pestoides F)
A9R6I9 1.89e-95 284 54 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CJ75 1.89e-95 284 54 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis
Q1C6D8 1.89e-95 284 54 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A8GGZ0 6.42e-95 282 54 0 237 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Serratia proteamaculans (strain 568)
B1JH89 6.63e-95 282 53 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669C8 6.63e-95 282 53 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K7Z2 1.1e-94 282 53 1 258 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JKU0 1.87e-94 281 52 1 259 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D7W3 7.79e-88 264 52 0 238 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MHU5 2.3e-80 245 51 0 235 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B7LM67 1.77e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q31YJ4 2.23e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella boydii serotype 4 (strain Sb227)
B7LAS9 2.23e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain 55989 / EAEC)
A7ZP82 2.23e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R9F0 2.6e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain UTI89 / UPEC)
A1ADB5 2.6e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O1:K1 / APEC
B7MG31 2.6e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8FFL2 2.96e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFH8 2.96e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXU6 2.96e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O81 (strain ED1a)
B7UFS6 2.96e-77 237 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4WCP8 3.32e-77 237 50 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Enterobacter sp. (strain 638)
Q32DS5 1.02e-76 235 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella dysenteriae serotype 1 (strain Sd197)
B2TW49 2.4e-76 234 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7M5U6 5.66e-76 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O8 (strain IAI1)
Q83QT4 6.11e-76 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella flexneri
Q0T2M0 6.11e-76 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella flexneri serotype 5b (strain 8401)
A8A2D1 6.89e-76 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O9:H4 (strain HS)
B6I7K7 7.27e-76 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain SE11)
B5YXQ7 1.23e-75 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDX9 1.23e-75 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O157:H7
Q3YZU3 1.41e-75 233 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella sonnei (strain Ss046)
P37355 2.05e-75 232 48 1 239 1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12)
B1X8X7 2.05e-75 232 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12 / DH10B)
C4ZUA6 2.05e-75 232 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7NNU3 4.25e-75 231 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1IXS3 7.32e-75 231 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B5XNX1 7.65e-75 231 48 1 252 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Klebsiella pneumoniae (strain 342)
B1LLL8 7.65e-75 231 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain SMS-3-5 / SECEC)
A6TBV7 1.73e-74 230 48 1 252 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7N5M9 2.32e-74 229 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A8ADX0 9.98e-74 228 47 1 253 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8ZNE9 2.54e-71 222 48 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MJB7 5.39e-71 221 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C0Q060 1.97e-70 219 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi C (strain RKS4594)
Q57M48 1.97e-70 219 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella choleraesuis (strain SC-B67)
B4TPJ1 2.34e-70 219 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella schwarzengrund (strain CVM19633)
B4SYY0 2.58e-70 219 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella newport (strain SL254)
B5EZI7 3.46e-70 219 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella agona (strain SL483)
B5BCN7 3.77e-70 219 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PN75 3.77e-70 219 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RCD3 4.25e-70 218 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2Y9 4.25e-70 218 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella enteritidis PT4 (strain P125109)
A9N5A3 4.64e-70 218 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TBH5 6.79e-70 218 47 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella heidelberg (strain SL476)
B5FPE7 2.73e-69 216 47 1 237 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella dublin (strain CT_02021853)
Q8Z534 3.27e-67 211 46 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella typhi
P44611 1.24e-57 186 41 2 238 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23974 1.27e-26 107 27 6 264 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Bacillus subtilis (strain 168)
Q15KI9 8.7e-16 80 25 6 253 2 PHYLLO Protein PHYLLO, chloroplastic Arabidopsis thaliana
Q57427 1.45e-05 48 23 9 247 3 HI_0193 Putative esterase/lipase HI_0193 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
K0KSN3 1.94e-05 48 27 2 99 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces ciferrii (strain ATCC 14091 / BCRC 22168 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031 F-60-10)
Q2TAP9 3.34e-05 47 34 1 83 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus laevis
A0A1E3P8S8 3.35e-05 47 28 2 99 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8)
Q0V9K2 3.97e-05 47 32 1 89 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus tropicalis
I1R9B2 6.23e-05 47 32 6 129 3 FGRAMPH1_01T00149 AB hydrolase superfamily protein FGSG_00045 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q6DRD9 0.000156 45 28 2 115 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Danio rerio
Q3SZ73 0.000231 45 34 1 86 1 ABHD11 sn-1-specific diacylglycerol lipase ABHD11 Bos taurus
P75736 0.001 43 31 2 86 1 ybfF Esterase YbfF Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08560
Feature type CDS
Gene menH
Product 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase
Location 1866777 - 1867544 (strand: -1)
Length 768 (nucleotides) / 255 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1883
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12697 Alpha/beta hydrolase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Kegg Ortholog Annotation(s)

Protein Sequence

MTLACRQYNTHNEGPWLVWLHGLLGDSHEWETVIKACHEYPSLVIDLPRHGNSASIGVNNFVEMSALLHDTLKEYDINHYWLIGYSLGGRIAMYHACFGETSGLMGLIVEGGNPGLYDAIERQNRIAHDKRWAARFRNEPINDVLTQWYQQPVFADLSDEMRQLLVEKRSSNAGFCIAESLETLSLGHQPWLVAELQQLTLPFIWLCGEQDKKFQSIAQQYSLPLTTIPQAGHNAHQAQPDAYAAVINHVLSLFG

Flanking regions ( +/- flanking 50bp)

AACTGAGGGTGCTGAAACCTTAAATCAGTTGGTAAAACAGGTAACCGCTTATGACTTTAGCTTGTAGGCAATATAACACGCATAACGAAGGGCCATGGTTAGTTTGGTTGCATGGACTATTAGGAGACAGTCATGAGTGGGAGACCGTCATTAAGGCTTGCCATGAATATCCCTCACTCGTGATTGATTTGCCCCGTCATGGTAACTCTGCCTCTATTGGGGTAAATAATTTTGTCGAGATGAGTGCATTACTCCATGACACTTTAAAAGAATACGATATTAATCATTACTGGCTGATTGGTTACTCTTTAGGTGGCAGAATTGCGATGTATCACGCATGTTTTGGTGAAACATCGGGATTAATGGGATTGATTGTTGAAGGGGGAAACCCAGGTTTATATGATGCAATAGAAAGACAAAACCGTATTGCACATGATAAACGTTGGGCCGCGCGTTTTCGCAATGAACCTATTAATGATGTATTAACGCAATGGTATCAACAGCCTGTCTTTGCTGATTTAAGCGATGAAATGCGTCAGTTATTAGTTGAAAAACGCAGTAGTAATGCAGGTTTTTGTATTGCGGAAAGTTTAGAAACACTCTCTTTAGGCCATCAGCCTTGGTTAGTTGCAGAATTACAACAACTCACCTTACCCTTTATTTGGTTGTGTGGTGAGCAAGATAAAAAATTTCAATCAATAGCGCAGCAATATTCGCTGCCATTAACGACTATCCCGCAAGCTGGTCATAATGCCCATCAGGCACAGCCTGATGCTTATGCTGCGGTGATAAACCATGTATTATCCCTCTTTGGTTAAAGGAACCTAATTATGCTTTACCCGAGCGAAGAAAAGCTATATGCACCGAT