Homologs in group_1921

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14080 FBDBKF_14080 74.3 Morganella morganii S1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
EHELCC_08200 EHELCC_08200 74.3 Morganella morganii S2 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
NLDBIP_08525 NLDBIP_08525 74.3 Morganella morganii S4 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
LHKJJB_05740 LHKJJB_05740 74.3 Morganella morganii S3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
HKOGLL_05175 HKOGLL_05175 74.3 Morganella morganii S5 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
PMI_RS08560 PMI_RS08560 50.6 Proteus mirabilis HI4320 menH 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

Distribution of the homologs in the orthogroup group_1921

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1921

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A7FGT3 1.78e-92 276 53 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JKU0 1.23e-91 274 55 0 245 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1CHT0 9.66e-91 272 52 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A4TM07 1.38e-90 271 52 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis (strain Pestoides F)
A9R6I9 1.38e-90 271 52 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CJ75 1.38e-90 271 52 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis
Q1C6D8 1.38e-90 271 52 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
B1JH89 3.9e-90 270 51 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669C8 3.9e-90 270 51 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K7Z2 8.02e-90 270 51 1 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A8GGZ0 5.94e-81 246 51 0 237 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Serratia proteamaculans (strain 568)
Q7N2K4 5.9e-80 245 50 1 255 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D7W3 5.84e-79 241 47 0 238 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MHU5 8.96e-68 213 46 1 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B5XNX1 3.99e-61 196 44 1 248 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Klebsiella pneumoniae (strain 342)
A6TBV7 5.96e-61 195 43 1 248 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WCP8 8.88e-61 195 44 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Enterobacter sp. (strain 638)
Q1R9F0 1.04e-60 195 42 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain UTI89 / UPEC)
A1ADB5 1.04e-60 195 42 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O1:K1 / APEC
B7MG31 1.04e-60 195 42 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q31YJ4 1.19e-60 194 43 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella boydii serotype 4 (strain Sb227)
B7LAS9 1.19e-60 194 43 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain 55989 / EAEC)
A7ZP82 1.19e-60 194 43 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LM67 1.9e-60 194 43 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A9MJB7 2.03e-60 194 43 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32DS5 2.05e-60 194 43 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella dysenteriae serotype 1 (strain Sd197)
B2TW49 5.81e-60 193 43 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7NNU3 2.43e-59 191 42 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B6I7K7 2.92e-59 191 43 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain SE11)
Q8FFL2 3.75e-59 191 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFH8 3.75e-59 191 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXU6 3.75e-59 191 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O81 (strain ED1a)
Q3YZU3 4.04e-59 191 42 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella sonnei (strain Ss046)
Q83QT4 4.97e-59 191 43 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella flexneri
Q0T2M0 4.97e-59 191 43 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella flexneri serotype 5b (strain 8401)
B1LLL8 6.59e-59 190 42 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain SMS-3-5 / SECEC)
P37355 8.54e-59 190 42 2 247 1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12)
B1X8X7 8.54e-59 190 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12 / DH10B)
C4ZUA6 8.54e-59 190 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B5YXQ7 9.83e-59 190 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDX9 9.83e-59 190 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O157:H7
B7M5U6 1.22e-58 189 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O8 (strain IAI1)
B7UFS6 1.28e-58 189 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1IXS3 3.42e-58 188 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2D1 4.63e-58 188 42 2 247 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O9:H4 (strain HS)
B4TBH5 7.14e-58 187 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella heidelberg (strain SL476)
B4TPJ1 8.49e-58 187 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella schwarzengrund (strain CVM19633)
C0Q060 8.58e-58 187 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi C (strain RKS4594)
Q57M48 8.58e-58 187 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella choleraesuis (strain SC-B67)
Q8ZNE9 8.68e-58 187 41 2 256 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B7N5M9 1.32e-57 187 42 2 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A9N5A3 1.37e-57 187 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SYY0 1.44e-57 187 41 2 256 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella newport (strain SL254)
B5RCD3 1.73e-57 186 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2Y9 1.73e-57 186 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella enteritidis PT4 (strain P125109)
B5BCN7 2.51e-57 186 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PN75 2.51e-57 186 42 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8ADX0 5.71e-57 185 43 1 249 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5FPE7 1.31e-56 184 41 2 256 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella dublin (strain CT_02021853)
B5EZI7 1.48e-56 184 41 1 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella agona (strain SL483)
Q8Z534 2.07e-55 181 40 2 256 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella typhi
P44611 1.09e-51 171 38 4 239 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23974 7.03e-29 113 29 8 277 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Bacillus subtilis (strain 168)
Q15KI9 1.06e-23 103 26 5 269 2 PHYLLO Protein PHYLLO, chloroplastic Arabidopsis thaliana
B3PI89 1.08e-08 58 26 12 255 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
Q7MPY0 1.72e-07 54 27 13 269 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio vulnificus (strain YJ016)
Q8K4F5 1.99e-07 54 24 7 258 1 Abhd11 sn-1-specific diacylglycerol lipase ABHD11 Mus musculus
Q8D1X1 2.41e-07 53 23 10 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Wigglesworthia glossinidia brevipalpis
Q8GHL1 3.59e-07 53 27 9 249 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Serratia marcescens
Q8DDU4 1.72e-06 51 27 14 268 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio vulnificus (strain CMCP6)
A0A061B0Q2 1.75e-06 52 30 2 96 1 EAT1 Ethanol acetyltransferase 1 Cyberlindnera fabianii
Q8NFV4 1.81e-06 51 27 12 263 1 ABHD11 sn-1-specific diacylglycerol lipase ABHD11 Homo sapiens
C5BMZ8 3.74e-06 51 27 12 267 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3SZ73 3.9e-06 50 24 10 265 1 ABHD11 sn-1-specific diacylglycerol lipase ABHD11 Bos taurus
A0A1E3P8S8 6.32e-06 50 30 1 83 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8)
K0KPV8 1.47e-05 49 29 3 98 1 EAT1 Ethanol acetyltransferase 1 Wickerhamomyces ciferrii (strain ATCC 14091 / BCRC 22168 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031 F-60-10)
O34592 1.83e-05 48 24 9 255 2 ydjP AB hydrolase superfamily protein YdjP Bacillus subtilis (strain 168)
B6EPQ0 2e-05 48 28 10 211 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Aliivibrio salmonicida (strain LFI1238)
A0A1E4S2P1 2.27e-05 48 26 2 96 1 EAT1 Ethanol acetyltransferase 1 Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / BCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542)
A0A1E3P8S6 2.27e-05 48 30 3 98 1 EAT1 Ethanol acetyltransferase 1 Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8)
B7VHH1 2.65e-05 47 26 8 210 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio atlanticus (strain LGP32)
A1JSF8 3.38e-05 47 27 12 247 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MST3 5.71e-05 47 28 9 204 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio campbellii (strain ATCC BAA-1116)
K0KSN3 7.18e-05 47 25 2 96 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces ciferrii (strain ATCC 14091 / BCRC 22168 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031 F-60-10)
B4SVL3 7.34e-05 46 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella newport (strain SL254)
Q6DRD9 0.000217 45 25 12 259 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Danio rerio
Q87TC2 0.000335 44 27 9 204 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2NQH6 0.000338 44 26 11 252 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Sodalis glossinidius (strain morsitans)
B5F8M6 0.000416 44 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella agona (strain SL483)
Q8ZLI9 0.000423 44 27 14 254 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TKT6 0.000423 44 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella heidelberg (strain SL476)
B5FJT1 0.000423 44 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella dublin (strain CT_02021853)
Q8Z221 0.000514 43 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella typhi
B5BHG7 0.000514 43 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella paratyphi A (strain AKU_12601)
C0Q0I5 0.000514 43 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella paratyphi C (strain RKS4594)
Q5PLY8 0.000514 43 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5R7K5 0.000514 43 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R369 0.000514 43 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella enteritidis PT4 (strain P125109)
Q57IW5 0.000514 43 27 14 254 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella choleraesuis (strain SC-B67)
A9MMB5 0.000762 43 26 11 249 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
I6XU97 0.001 43 23 7 260 1 Rv0045c Esterase Rv0045c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02855
Feature type CDS
Gene menH
Product 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase
Location 605265 - 606050 (strand: 1)
Length 786 (nucleotides) / 261 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1921
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12697 Alpha/beta hydrolase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)
HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Kegg Ortholog Annotation(s)

Protein Sequence

MTVLASRKFAAQKGTQKTGPWLVWLHGLWGCKEEWQPIINNTGNYPSLVIDLPGHGESVSLRAENFEQVNQQIHVTLSANGIDDYWLIGYSLGGRLAMYHAAFGKPAGLRGLIIEAGNSGLTTADERNARLRHDNHLAQQLRERPLADFLYDWYRQGVFADLSEAQRQQRVAQHLHYNACAVADMLSDTSLGHQPDLADILKQLTVPLLYICGERDTKFCAIAHAHQFTLRTIPDAGHNTHQANPAAFAHAIRTFLSLHSV

Flanking regions ( +/- flanking 50bp)

GGAGACACCGGCGCGCGCTGTCTTCAGCAACTCGTCAGTGAGACAGCGCAATGACGGTGCTTGCCTCGCGCAAATTTGCTGCACAAAAGGGTACACAAAAGACGGGTCCCTGGTTAGTCTGGCTTCATGGACTGTGGGGATGCAAAGAAGAGTGGCAGCCGATCATTAATAACACAGGGAATTATCCGTCACTGGTGATTGACCTGCCCGGACACGGTGAGTCTGTCTCCCTGCGTGCGGAAAATTTTGAACAGGTAAACCAGCAGATTCACGTCACACTCTCTGCAAACGGTATTGATGATTACTGGTTGATCGGTTATTCCCTGGGCGGACGGCTGGCAATGTACCATGCTGCATTTGGCAAGCCTGCCGGATTGCGCGGGCTGATTATCGAAGCGGGAAACTCCGGGCTTACCACAGCGGATGAACGCAATGCCCGCCTCCGGCATGATAATCACCTGGCGCAGCAGTTACGTGAGCGCCCGCTGGCAGACTTCCTGTATGACTGGTATCGTCAGGGGGTATTTGCGGATCTCAGTGAGGCTCAGCGACAGCAGCGGGTAGCGCAGCATCTGCATTATAATGCATGTGCGGTTGCAGATATGCTGTCTGACACCTCGCTGGGGCACCAGCCGGATCTGGCTGATATTCTGAAACAGCTTACCGTCCCGCTGTTGTATATTTGCGGTGAACGGGATACAAAATTTTGCGCCATCGCGCACGCGCACCAATTTACGTTACGGACAATTCCGGATGCCGGGCATAATACCCATCAGGCAAACCCTGCGGCATTTGCACACGCAATCCGGACATTTTTATCATTACATTCTGTTTAAAGGAACTCACCGTTATGATGTACCCGAGCGAAGAGCAGCTCTGTGCCCCG