Homologs in group_1921

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14080 FBDBKF_14080 100.0 Morganella morganii S1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
EHELCC_08200 EHELCC_08200 100.0 Morganella morganii S2 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
NLDBIP_08525 NLDBIP_08525 100.0 Morganella morganii S4 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
HKOGLL_05175 HKOGLL_05175 100.0 Morganella morganii S5 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
F4V73_RS02855 F4V73_RS02855 74.3 Morganella psychrotolerans menH 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase
PMI_RS08560 PMI_RS08560 51.0 Proteus mirabilis HI4320 menH 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

Distribution of the homologs in the orthogroup group_1921

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1921

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JKU0 7.46e-89 267 54 0 242 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7FGT3 3.17e-86 260 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JH89 5.84e-86 259 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669C8 5.84e-86 259 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K7Z2 1.52e-85 259 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CHT0 1.85e-85 258 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A4TM07 7.41e-85 257 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis (strain Pestoides F)
A9R6I9 7.41e-85 257 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q7CJ75 7.41e-85 257 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis
Q1C6D8 7.41e-85 257 51 2 260 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q7N2K4 1.13e-82 251 54 1 245 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GGZ0 4.38e-82 249 51 1 246 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Serratia proteamaculans (strain 568)
Q6D7W3 4.43e-82 249 50 0 238 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MHU5 7.85e-75 231 48 0 235 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Cronobacter sakazakii (strain ATCC BAA-894)
A6TBV7 4.9e-67 211 46 2 242 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNX1 3.74e-66 209 46 1 238 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Klebsiella pneumoniae (strain 342)
A9MJB7 5.3e-66 208 45 1 239 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7LM67 6.3e-66 208 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q31YJ4 3.7e-65 206 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella boydii serotype 4 (strain Sb227)
B7LAS9 3.7e-65 206 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain 55989 / EAEC)
A7ZP82 3.7e-65 206 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32DS5 4.96e-65 206 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella dysenteriae serotype 1 (strain Sd197)
B7NNU3 1.52e-64 204 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8FFL2 2.01e-64 204 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFH8 2.01e-64 204 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXU6 2.01e-64 204 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O81 (strain ED1a)
Q1R9F0 2.1e-64 204 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain UTI89 / UPEC)
A1ADB5 2.1e-64 204 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O1:K1 / APEC
B7MG31 2.1e-64 204 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B2TW49 2.3e-64 204 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLL8 3.58e-64 203 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I7K7 4.08e-64 203 44 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain SE11)
B7UFS6 9.02e-64 202 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5YXQ7 9.62e-64 202 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDX9 9.62e-64 202 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O157:H7
B5EZI7 1.22e-63 202 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella agona (strain SL483)
P37355 1.77e-63 202 43 2 241 1 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12)
B1X8X7 1.77e-63 202 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12 / DH10B)
C4ZUA6 1.77e-63 202 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5U6 2.01e-63 201 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O8 (strain IAI1)
A8A2D1 2.08e-63 201 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O9:H4 (strain HS)
B4TBH5 2.88e-63 201 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella heidelberg (strain SL476)
C0Q060 3.7e-63 201 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi C (strain RKS4594)
Q57M48 3.7e-63 201 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella choleraesuis (strain SC-B67)
Q83QT4 3.78e-63 201 43 1 250 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella flexneri
Q0T2M0 3.78e-63 201 43 1 250 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella flexneri serotype 5b (strain 8401)
B7N5M9 4.75e-63 201 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B4TPJ1 4.9e-63 201 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella schwarzengrund (strain CVM19633)
A4WCP8 5.06e-63 201 45 2 248 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Enterobacter sp. (strain 638)
A8ADX0 5.12e-63 201 45 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1IXS3 6.16e-63 200 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B4SYY0 6.79e-63 200 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella newport (strain SL254)
A9N5A3 7.17e-63 200 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RCD3 9.71e-63 200 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2Y9 9.71e-63 200 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella enteritidis PT4 (strain P125109)
Q8ZNE9 1.37e-62 199 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BCN7 1.48e-62 199 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PN75 1.48e-62 199 44 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3YZU3 4.3e-62 198 43 2 241 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Shigella sonnei (strain Ss046)
B5FPE7 7.63e-62 197 44 1 237 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella dublin (strain CT_02021853)
Q8Z534 4.56e-60 193 43 2 243 3 menH 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Salmonella typhi
P44611 1.05e-52 174 37 2 238 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23974 2.7e-27 109 31 8 251 3 menH Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Bacillus subtilis (strain 168)
Q15KI9 3.16e-19 90 26 8 265 2 PHYLLO Protein PHYLLO, chloroplastic Arabidopsis thaliana
P75333 1.16e-07 55 25 9 251 3 MPN_445 Putative esterase/lipase 1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A0A1E3P8S8 1.19e-06 52 29 1 96 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8)
Q8GHL1 3.13e-06 50 38 5 106 1 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Serratia marcescens
A0A061B0Q2 9.2e-06 49 30 2 90 1 EAT1 Ethanol acetyltransferase 1 Cyberlindnera fabianii
P75736 4.38e-05 47 31 2 91 1 ybfF Esterase YbfF Escherichia coli (strain K12)
K0KSN3 5.6e-05 47 26 1 83 3 EAT2 Probable alcohol acetyltransferase Wickerhamomyces ciferrii (strain ATCC 14091 / BCRC 22168 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031 F-60-10)
A0A1E3P8S6 7.32e-05 47 27 1 97 1 EAT1 Ethanol acetyltransferase 1 Wickerhamomyces anomalus (strain ATCC 58044 / CBS 1984 / NCYC 433 / NRRL Y-366-8)
K0KPV8 9.3e-05 46 27 1 97 1 EAT1 Ethanol acetyltransferase 1 Wickerhamomyces ciferrii (strain ATCC 14091 / BCRC 22168 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031 F-60-10)
Q0V9K2 0.000114 46 34 1 84 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus tropicalis
Q2TAP9 0.000206 45 34 1 83 2 abhd11 sn-1-specific diacylglycerol lipase ABHD11 Xenopus laevis
A8GKT5 0.000221 45 24 8 249 3 bioH Pimeloyl-[acyl-carrier protein] methyl ester esterase Serratia proteamaculans (strain 568)
Q8K4F5 0.000831 43 23 8 258 1 Abhd11 sn-1-specific diacylglycerol lipase ABHD11 Mus musculus
Q57427 0.000878 43 31 1 80 3 HI_0193 Putative esterase/lipase HI_0193 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05740
Feature type CDS
Gene menH
Product 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy late synthase
Location 148563 - 149336 (strand: -1)
Length 774 (nucleotides) / 257 (amino acids)
In genomic island -

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1921
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12697 Alpha/beta hydrolase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0596 Coenzyme transport and metabolism (H)
General function prediction only (R)
HR 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold

Kegg Ortholog Annotation(s)

Protein Sequence

MTVLAAQRCYADRPGPWLVWLHGLWGNKEEWLTAAAEAGNYPSLLIDLPGHGGSQSVRAKNFPHVSQLIADTLAAHQADDYWLIGYSLGGRLAMYHAAYGDRAGLRGLIIEAGNPGLATLDERNARLLHDNRWAQQLRERPLASVLYDWYRQGVFADLNEVQRQQRVEQHLHHNAFAIADMLSDTSLGHQPQLAEKLHALNLPLLYLCGERDSKFRAIAEAHHFPLRTIQYAGHNTHQANPAAFAETVRTFLSLHSV

Flanking regions ( +/- flanking 50bp)

GGCGACGAGGGCGCAAAATACCTTCAGCAGCTGGTCCGTGAGGCAGCACAATGACGGTTCTGGCCGCACAGCGCTGTTATGCGGACAGGCCCGGTCCGTGGCTGGTCTGGCTGCACGGTCTGTGGGGAAATAAAGAAGAGTGGCTGACGGCAGCAGCAGAAGCCGGAAATTATCCCTCATTACTGATTGATTTGCCGGGTCACGGCGGCTCACAATCCGTCCGCGCAAAAAATTTTCCGCATGTCAGTCAGCTGATTGCTGATACCCTGGCCGCACATCAGGCAGACGATTACTGGCTGATTGGCTACTCTCTCGGCGGGCGGCTGGCGATGTATCACGCTGCATACGGCGACCGGGCAGGGTTGCGCGGTCTGATTATTGAAGCCGGGAATCCCGGGCTTGCCACACTCGATGAGCGCAATGCCCGGCTGCTGCATGATAACCGCTGGGCACAACAGTTACGTGAACGTCCGCTGGCATCGGTGCTGTATGACTGGTATCGTCAGGGCGTTTTTGCTGATCTCAATGAGGTTCAGCGGCAGCAGCGGGTAGAGCAGCATCTGCATCATAATGCTTTTGCGATCGCGGATATGCTGTCGGACACCTCGCTCGGGCATCAGCCGCAGCTGGCGGAGAAACTGCATGCCCTGAATCTGCCGCTGCTCTATCTCTGCGGTGAGCGGGACAGCAAATTCCGCGCCATTGCAGAGGCACACCATTTTCCGTTACGGACTATCCAATATGCCGGGCATAACACCCATCAGGCAAATCCCGCTGCGTTTGCGGAGACAGTCCGGACATTTTTATCATTACATTCTGTTTAAGGAACTCACCGCTATGATGTATCCGAGCGAAGAAAAGCTCTCTGCCCCGG