Homologs in group_1881

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14065 FBDBKF_14065 49.8 Morganella morganii S1 menE o-succinylbenzoate--CoA ligase
EHELCC_08215 EHELCC_08215 49.8 Morganella morganii S2 menE o-succinylbenzoate--CoA ligase
NLDBIP_08540 NLDBIP_08540 49.8 Morganella morganii S4 menE o-succinylbenzoate--CoA ligase
LHKJJB_05725 LHKJJB_05725 49.8 Morganella morganii S3 menE o-succinylbenzoate--CoA ligase
HKOGLL_05190 HKOGLL_05190 49.8 Morganella morganii S5 menE o-succinylbenzoate--CoA ligase
F4V73_RS02870 F4V73_RS02870 49.1 Morganella psychrotolerans menE o-succinylbenzoate--CoA ligase

Distribution of the homologs in the orthogroup group_1881

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1881

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37418 7.11e-169 486 52 5 465 3 menE 2-succinylbenzoate--CoA ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37353 1.84e-154 449 51 4 466 1 menE 2-succinylbenzoate--CoA ligase Escherichia coli (strain K12)
P44565 3.07e-120 362 45 11 476 3 menE 2-succinylbenzoate--CoA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A8FGK6 9.69e-44 163 29 13 484 3 menE 2-succinylbenzoate--CoA ligase Bacillus pumilus (strain SAFR-032)
B7JDD6 1.75e-42 160 30 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus cereus (strain AH820)
Q81K97 1.87e-42 160 30 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus anthracis
C3LB87 1.9e-42 160 30 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PCK3 1.9e-42 160 30 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus anthracis (strain A0248)
A0RK73 2.5e-42 159 30 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus thuringiensis (strain Al Hakam)
Q816I1 2.68e-42 159 29 14 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HC29 3.75e-42 159 30 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q72YK9 4.04e-42 159 29 14 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7HTW3 3.08e-41 156 29 14 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus cereus (strain AH187)
Q65FT5 3.56e-41 156 28 13 478 3 menE 2-succinylbenzoate--CoA ligase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q632I5 1.25e-40 155 29 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus cereus (strain ZK / E33L)
B9J2F2 3.51e-40 154 29 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus cereus (strain Q1)
C5D6U5 1.2e-39 152 28 14 493 3 menE 2-succinylbenzoate--CoA ligase Geobacillus sp. (strain WCH70)
Q838K1 1.52e-38 149 29 13 456 3 menE 2-succinylbenzoate--CoA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
A9VM74 7.09e-38 147 28 13 476 3 menE 2-succinylbenzoate--CoA ligase Bacillus mycoides (strain KBAB4)
Q71YZ5 8.97e-38 147 27 14 464 3 menE 2-succinylbenzoate--CoA ligase Listeria monocytogenes serotype 4b (strain F2365)
P23971 2.85e-37 145 28 13 490 1 menE 2-succinylbenzoate--CoA ligase Bacillus subtilis (strain 168)
P58730 1.38e-36 143 26 14 470 3 menE 2-succinylbenzoate--CoA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5KVX9 2.44e-36 143 28 15 483 3 menE 2-succinylbenzoate--CoA ligase Geobacillus kaustophilus (strain HTA426)
S5M744 7.37e-35 139 26 14 497 1 fcs Feruloyl-CoA synthase Streptomyces sp.
Q9EY88 7.37e-35 139 26 14 497 1 fcs Feruloyl-CoA synthase Amycolatopsis sp.
Q92AY8 1.32e-34 138 27 14 465 3 menE 2-succinylbenzoate--CoA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A7GU88 1.65e-34 138 29 15 465 3 menE 2-succinylbenzoate--CoA ligase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5HNB2 4.23e-34 137 27 15 474 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CS21 6.34e-34 136 27 15 471 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9CHK3 3.04e-31 128 26 14 452 3 menE 2-succinylbenzoate--CoA ligase Lactococcus lactis subsp. lactis (strain IL1403)
A7Z809 3.3e-31 129 26 12 484 3 menE 2-succinylbenzoate--CoA ligase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8NVZ4 3.28e-29 123 24 12 473 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain MW2)
Q6G8D6 3.28e-29 123 24 12 473 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain MSSA476)
P63526 6.12e-29 122 24 13 473 1 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain N315)
P63525 6.12e-29 122 24 13 473 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ITW2 6.12e-29 122 24 13 473 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain JH9)
A6U2Q7 6.12e-29 122 24 13 473 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain JH1)
A7X3P0 6.12e-29 122 24 13 473 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GFR0 7.1e-28 119 24 12 470 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain MRSA252)
Q2YTP0 7.45e-28 119 24 13 473 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q53634 9.55e-28 119 25 14 474 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus
A8Z4L9 9.55e-28 119 25 14 474 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain USA300 / TCH1516)
A6QHX6 9.55e-28 119 25 14 474 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain Newman)
Q5HEY2 9.55e-28 119 25 14 474 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain COL)
Q2G2V3 9.55e-28 119 25 14 474 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FFU9 9.55e-28 119 25 14 474 3 menE 2-succinylbenzoate--CoA ligase Staphylococcus aureus (strain USA300)
Q8ENZ7 1.68e-27 118 25 14 484 3 menE 2-succinylbenzoate--CoA ligase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5P603 1.15e-24 110 26 17 521 1 iaaB Indoleacetate--CoA ligase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
O07610 8.82e-24 107 21 12 501 2 lcfB Long-chain-fatty-acid--CoA ligase Bacillus subtilis (strain 168)
P9WQ37 4.81e-23 105 23 10 492 1 fadD13 Long-chain-fatty-acid--CoA ligase FadD13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ36 4.81e-23 105 23 10 492 3 fadD13 Long-chain-fatty-acid--CoA ligase FadD13 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q70LM5 3.42e-22 104 21 10 491 3 lgrC Linear gramicidin synthase subunit C Brevibacillus parabrevis
Q70LM5 7.32e-19 94 24 11 416 3 lgrC Linear gramicidin synthase subunit C Brevibacillus parabrevis
Q70LM5 7.44e-18 90 23 12 443 3 lgrC Linear gramicidin synthase subunit C Brevibacillus parabrevis
Q70LM5 1.06e-14 80 24 15 435 3 lgrC Linear gramicidin synthase subunit C Brevibacillus parabrevis
Q70LM5 4.52e-14 79 21 13 481 3 lgrC Linear gramicidin synthase subunit C Brevibacillus parabrevis
Q70LM5 2.42e-12 73 24 14 444 3 lgrC Linear gramicidin synthase subunit C Brevibacillus parabrevis
O80658 1.24e-21 101 26 18 522 2 AEE4 Probable acyl-activating enzyme 4 Arabidopsis thaliana
W3X8X8 1.28e-21 102 24 14 457 1 fnsA Naringenin synthase Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
O24145 9.25e-21 98 23 14 460 2 4CL1 4-coumarate--CoA ligase 1 Nicotiana tabacum
M4IQR7 9.38e-21 98 25 17 439 2 CCL5 Probable CoA ligase CCL5 Humulus lupulus
Q70LM6 3.64e-20 98 24 18 484 1 lgrB Linear gramicidin synthase subunit B Brevibacillus parabrevis
Q70LM6 2.27e-15 83 23 17 493 1 lgrB Linear gramicidin synthase subunit B Brevibacillus parabrevis
Q70LM6 6.01e-15 81 23 16 498 1 lgrB Linear gramicidin synthase subunit B Brevibacillus parabrevis
Q70LM6 3.01e-05 50 27 3 158 1 lgrB Linear gramicidin synthase subunit B Brevibacillus parabrevis
Q70LM4 6.44e-20 97 23 14 489 1 lgrD Linear gramicidin synthase subunit D Brevibacillus parabrevis
Q70LM4 1.18e-17 90 24 14 432 1 lgrD Linear gramicidin synthase subunit D Brevibacillus parabrevis
Q70LM4 6.26e-13 75 22 14 479 1 lgrD Linear gramicidin synthase subunit D Brevibacillus parabrevis
Q70LM4 4.83e-09 62 29 1 146 1 lgrD Linear gramicidin synthase subunit D Brevibacillus parabrevis
M4IRL6 6.69e-20 95 24 16 502 2 CCL7 Probable CoA ligase CCL7 Humulus lupulus
M4ISH0 6.96e-20 95 23 13 491 1 CCL1 4-coumarate--CoA ligase CCL1 Humulus lupulus
P96575 1.77e-19 94 23 8 438 3 ydaB Putative acyl--CoA ligase YdaB Bacillus subtilis (strain 168)
P9WQ39 2.03e-19 93 28 7 283 1 menE Probable 2-succinylbenzoate--CoA ligase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ38 2.03e-19 93 28 7 283 3 menE Probable 2-succinylbenzoate--CoA ligase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O30408 2.16e-19 95 23 11 428 1 tycB Tyrocidine synthase 2 Brevibacillus parabrevis
O30408 7.25e-12 72 23 17 502 1 tycB Tyrocidine synthase 2 Brevibacillus parabrevis
O30408 2.06e-11 70 21 14 426 1 tycB Tyrocidine synthase 2 Brevibacillus parabrevis
Q5SKN9 4.94e-19 93 24 13 496 1 TTHA0604 Long-chain-fatty-acid--CoA ligase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
M4IQQ7 6.67e-19 92 23 17 520 2 CCL9 Probable CoA ligase CCL9 Humulus lupulus
Q9LPK6 7.08e-19 92 25 17 535 2 AEE9 Probable acyl-activating enzyme 9 Arabidopsis thaliana
Q8H151 1.27e-18 92 25 11 377 1 AAE13 Malonate--CoA ligase Arabidopsis thaliana
D9XF47 1.43e-18 92 26 17 495 1 phsC Phosphinothricin tripeptide synthase PhsC Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)
O68007 1.5e-18 92 23 16 470 3 bacB Bacitracin synthase 2 Bacillus licheniformis
O68007 4.49e-09 62 21 17 502 3 bacB Bacitracin synthase 2 Bacillus licheniformis
O30409 1.53e-18 93 24 20 505 1 tycC Tyrocidine synthase 3 Brevibacillus parabrevis
O30409 2.65e-16 85 23 18 484 1 tycC Tyrocidine synthase 3 Brevibacillus parabrevis
O30409 3.91e-16 85 24 20 498 1 tycC Tyrocidine synthase 3 Brevibacillus parabrevis
O30409 4.13e-13 75 24 17 446 1 tycC Tyrocidine synthase 3 Brevibacillus parabrevis
O30409 9.97e-13 74 24 17 439 1 tycC Tyrocidine synthase 3 Brevibacillus parabrevis
O30409 1.45e-10 67 21 18 496 1 tycC Tyrocidine synthase 3 Brevibacillus parabrevis
E9F8M3 1.66e-18 92 26 12 423 1 swnK PKS-NRPS hybrid synthetase swnK Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q9R9J1 2.31e-18 92 23 17 481 1 mycA Mycosubtilin synthase subunit A Bacillus subtilis
Q9R9J1 4.9e-05 50 27 3 116 1 mycA Mycosubtilin synthase subunit A Bacillus subtilis
Q10S72 2.4e-18 91 28 12 302 2 4CLL4 4-coumarate--CoA ligase-like 4 Oryza sativa subsp. japonica
M4IQS1 2.66e-18 91 22 18 516 2 CCL10 Probable CoA ligase CCL10 Humulus lupulus
M4IQQ5 4.47e-18 90 26 11 358 1 CCL4 2-methylpropanoate--CoA ligase CCL4 Humulus lupulus
Q3URE1 5.7e-18 90 23 11 477 1 Acsf3 Malonate--CoA ligase ACSF3, mitochondrial Mus musculus
P0DX14 5.81e-18 90 25 20 498 1 scoC Fatty acid--[acyl-carrier-protein] ligase ScoC Streptomyces coeruleorubidus
P9WQ51 7.93e-18 89 23 15 520 1 fadD19 Medium/long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ50 7.93e-18 89 23 15 520 3 fadD19 Medium/long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TWB7 7.93e-18 89 23 15 520 3 fadD19 Medium/long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q84P21 8.4e-18 89 22 16 480 1 4CLL5 Peroxisomal OPC-8:0-CoA ligase 1 Arabidopsis thaliana
Q2UB01 1.09e-17 89 27 11 327 1 ppsA Acyl-CoA ligase ppsA Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q0S7V5 1.11e-17 89 22 14 493 1 fadD3 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase Rhodococcus jostii (strain RHA1)
P39845 1.3e-17 90 24 14 446 1 ppsA Plipastatin synthase subunit A Bacillus subtilis (strain 168)
P39845 1.04e-15 84 23 17 480 1 ppsA Plipastatin synthase subunit A Bacillus subtilis (strain 168)
A0A6B9HER0 1.32e-17 89 22 16 507 1 None Piperic acid--CoA ligase Piper nigrum
I3PB36 1.65e-17 89 23 16 528 1 CNL Trans-cinnamate:CoA ligase, peroxisomal Petunia hybrida
Q9SS01 1.75e-17 88 24 17 535 1 AAE20 Benzoate--CoA ligase, peroxisomal Arabidopsis thaliana
O31826 1.99e-17 88 24 8 307 3 yngI Putative acyl-CoA synthetase YngI Bacillus subtilis (strain 168)
I3PB37 2.81e-17 87 24 12 378 1 4CL1 4-coumarate:CoA ligase 1 Petunia hybrida
O24146 3.16e-17 87 21 15 515 1 4CL2 4-coumarate--CoA ligase 2 Nicotiana tabacum
Q9HWG3 3.18e-17 87 24 14 494 1 pchD Pyochelin synthase PchD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45745 3.43e-17 88 23 16 512 1 dhbF Dimodular nonribosomal peptide synthase Bacillus subtilis (strain 168)
P45745 7.35e-17 87 25 19 501 1 dhbF Dimodular nonribosomal peptide synthase Bacillus subtilis (strain 168)
P0DX16 3.72e-17 88 27 14 406 1 scoA Isonitrile lipopeptide synthase Streptomyces coeruleorubidus
P39847 3.73e-17 88 25 15 444 1 ppsC Plipastatin synthase subunit C Bacillus subtilis (strain 168)
P39847 1.17e-11 71 23 14 426 1 ppsC Plipastatin synthase subunit C Bacillus subtilis (strain 168)
P14913 3.84e-17 87 22 15 515 2 4CL2 4-coumarate--CoA ligase 2 Petroselinum crispum
Q9C8D4 4.14e-17 87 24 16 532 1 AAE11 Butyrate--CoA ligase AAE11, peroxisomal Arabidopsis thaliana
A0A0H2ZF83 5.44e-17 87 24 14 491 1 pchD Pyochelin synthase PchD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q70LM7 1.04e-16 87 24 18 431 1 lgrA Linear gramicidin synthase subunit A Brevibacillus parabrevis
Q70LM7 6.82e-16 84 22 16 499 1 lgrA Linear gramicidin synthase subunit A Brevibacillus parabrevis
Q9M0X9 1.47e-16 85 23 20 514 1 4CLL7 4-coumarate--CoA ligase-like 7 Arabidopsis thaliana
Q04747 1.68e-16 86 23 13 426 1 srfAB Surfactin synthase subunit 2 Bacillus subtilis (strain 168)
Q04747 1.95e-15 83 23 17 444 1 srfAB Surfactin synthase subunit 2 Bacillus subtilis (strain 168)
Q04747 0.000889 45 24 2 149 1 srfAB Surfactin synthase subunit 2 Bacillus subtilis (strain 168)
Q0VZ70 1.77e-16 86 27 19 448 1 cmdD Chondramide synthase cmdD Chondromyces crocatus
Q0VZ70 6.25e-10 65 23 19 507 1 cmdD Chondramide synthase cmdD Chondromyces crocatus
P39846 1.93e-16 86 24 19 481 1 ppsB Plipastatin synthase subunit B Bacillus subtilis (strain 168)
P39846 6.78e-12 72 23 18 468 1 ppsB Plipastatin synthase subunit B Bacillus subtilis (strain 168)
P14912 2.1e-16 85 22 15 515 2 4CL1 4-coumarate--CoA ligase 1 Petroselinum crispum
Q0K844 2.33e-16 85 24 13 437 2 sauT Sulfoacetate--CoA ligase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9SS00 2.73e-16 85 22 12 532 2 AAE12 Probable acyl-activating enzyme 12, peroxisomal Arabidopsis thaliana
B2HKM1 3.84e-16 84 25 21 496 1 mmaC Fatty acid--[acyl-carrier-protein] ligase MmaC Mycobacterium marinum (strain ATCC BAA-535 / M)
Q00594 4.06e-16 84 21 16 495 1 alkK Medium-chain-fatty-acid--CoA ligase Pseudomonas oleovorans
O24540 4.24e-16 84 25 11 348 2 4CL 4-coumarate--CoA ligase Vanilla planifolia
P38135 6.06e-16 84 21 10 455 1 fadK Medium-chain fatty-acid--CoA ligase Escherichia coli (strain K12)
B8N0E8 6.55e-16 84 22 17 515 2 asaC Nonribosomal peptide synthetase asaC Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
D4AU31 7.51e-16 84 24 14 474 3 swnK PKS-NRPS hybrid synthetase swnK Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
M4ISH2 9.49e-16 83 26 10 356 2 CCL11 Probable CoA ligase CCL11 Humulus lupulus
P94459 1.34e-15 83 24 13 425 1 ppsD Plipastatin synthase subunit D Bacillus subtilis (strain 168)
P94459 2.02e-14 80 25 16 436 1 ppsD Plipastatin synthase subunit D Bacillus subtilis (strain 168)
P94459 2.13e-11 70 23 16 447 1 ppsD Plipastatin synthase subunit D Bacillus subtilis (strain 168)
M4IRL4 1.51e-15 82 23 16 454 1 CCL2 Isovalerate--CoA ligase CCL2 Humulus lupulus
A0A2H5AIX5 2.24e-15 82 23 11 382 2 4CL1 4-coumarate-CoA ligase 1 Narcissus pseudonarcissus
Q9R9J0 2.64e-15 82 23 18 504 3 mycB Mycosubtilin synthase subunit B Bacillus subtilis
Q9R9J0 9.38e-13 74 23 19 441 3 mycB Mycosubtilin synthase subunit B Bacillus subtilis
Q9R9J0 1.35e-07 58 23 8 269 3 mycB Mycosubtilin synthase subunit B Bacillus subtilis
Q9R9J0 5.2e-06 53 21 15 448 3 mycB Mycosubtilin synthase subunit B Bacillus subtilis
P31684 2.86e-15 81 22 15 510 3 4CL1 4-coumarate--CoA ligase 1 Solanum tuberosum
Q58DN7 2.94e-15 81 25 11 380 2 ACSF3 Malonate--CoA ligase ACSF3, mitochondrial Bos taurus
Q8RU95 4.39e-15 81 25 7 320 2 4CLL6 4-coumarate--CoA ligase-like 6 Oryza sativa subsp. japonica
Q4L4U5 4.42e-15 80 22 14 501 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus haemolyticus (strain JCSC1435)
Q7X279 5.28e-15 80 23 16 524 1 sdgA Salicylyl-CoA synthase / salicylate adenylyltransferase Streptomyces sp.
P9WER8 5.82e-15 81 23 15 494 1 malA Malpinin synthetase Mortierella alpina
P9WER8 5.6e-13 75 23 15 460 1 malA Malpinin synthetase Mortierella alpina
P9WER8 1.13e-12 74 24 12 432 1 malA Malpinin synthetase Mortierella alpina
P9WER8 6.19e-12 72 24 18 439 1 malA Malpinin synthetase Mortierella alpina
P9WER8 2.16e-11 70 24 20 501 1 malA Malpinin synthetase Mortierella alpina
P9WER8 4.45e-11 69 23 17 437 1 malA Malpinin synthetase Mortierella alpina
P9WER8 3.66e-09 63 22 16 448 1 malA Malpinin synthetase Mortierella alpina
M4IS90 5.92e-15 80 24 11 350 2 CCL8 Probable CoA ligase CCL8 Humulus lupulus
Q9LPK7 6.09e-15 80 26 10 361 2 AEE10 Probable acyl-activating enzyme 10 Arabidopsis thaliana
Q6GLK6 7.3e-15 80 24 12 479 2 acsf3 Malonate--CoA ligase ACSF3, mitochondrial Xenopus laevis
G3XNF4 7.61e-15 81 23 13 463 1 ATPKS PKS-NRPS hybrid synthetase ATPKS Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q5LRT0 9.63e-15 80 22 13 414 1 dmdB 3-methylmercaptopropionyl-CoA ligase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
P86832 1e-14 80 23 20 519 1 fcbA2 4-chlorobenzoate--CoA ligase Arthrobacter sp.
P86831 1e-14 80 23 20 519 1 fcbA1 4-chlorobenzoate--CoA ligase Arthrobacter sp.
P0C397 1.43e-14 79 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus
P99107 1.43e-14 79 23 19 490 1 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain N315)
P68876 1.43e-14 79 23 19 490 1 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IRB0 1.43e-14 79 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain JH9)
A6U039 1.43e-14 79 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain JH1)
A7X0D6 1.43e-14 79 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9S725 1.98e-14 79 21 14 493 1 4CL2 4-coumarate--CoA ligase 2 Arabidopsis thaliana
A0A0A2J5U8 2.01e-14 79 27 9 296 3 cnsG Acyl-CoA ligase cnsG Penicillium expansum
A0R4Q2 2.05e-14 79 22 16 517 3 fadD19 Medium/long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9S777 2.05e-14 79 23 15 484 1 4CL3 4-coumarate--CoA ligase 3 Arabidopsis thaliana
Q08787 2.36e-14 79 22 16 442 1 srfAC Surfactin synthase subunit 3 Bacillus subtilis (strain 168)
Q2YWQ8 2.42e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A4YDR9 2.55e-14 79 21 14 485 1 Msed_0394 4-hydroxybutyrate--CoA ligase 2 Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
P31685 2.76e-14 78 21 15 510 3 4CL2 4-coumarate--CoA ligase 2 Solanum tuberosum
Q0DV32 3.46e-14 78 23 13 376 2 4CLL1 4-coumarate--CoA ligase-like 1 Oryza sativa subsp. japonica
Q4G176 3.46e-14 78 26 12 373 1 ACSF3 Malonate--CoA ligase ACSF3, mitochondrial Homo sapiens
P68878 3.51e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain MW2)
A8Z1J1 3.51e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GAZ4 3.51e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain MSSA476)
A6QFE3 3.51e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain Newman)
Q5HHF2 3.51e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain COL)
Q2FZW6 3.51e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIE3 3.51e-14 78 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain USA300)
M1WCQ3 3.73e-14 79 23 15 520 2 tcpP Nonribosomal peptide synthetase tcpP Claviceps purpurea (strain 20.1)
M4IS92 3.77e-14 78 23 16 454 2 CCL13 Probable CoA ligase CCL13 Humulus lupulus
P9WQ55 4.22e-14 78 25 15 463 1 fadD10 Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase FadD10 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ54 4.22e-14 78 25 15 463 3 fadD10 Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase FadD10 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6GIF6 4.28e-14 77 23 19 490 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus aureus (strain MRSA252)
Q42982 4.55e-14 78 24 12 369 1 4CL2 4-coumarate--CoA ligase 2 Oryza sativa subsp. japonica
Q7F1X5 4.72e-14 77 26 9 289 2 4CLL5 4-coumarate--CoA ligase-like 5 Oryza sativa subsp. japonica
Q7BQ71 5.43e-14 77 23 17 496 1 zmaJ Zwittermicin A synthase ZmaJ Bacillus cereus
P38137 5.85e-14 77 24 15 371 1 PCS60 Oxalate--CoA ligase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6ETN3 6.47e-14 77 24 11 353 1 4CL3 4-coumarate--CoA ligase 3 Oryza sativa subsp. japonica
Q9R9I9 8.13e-14 78 22 15 491 3 mycC Mycosubtilin synthase subunit C Bacillus subtilis
Q9R9I9 2.88e-11 70 20 16 446 3 mycC Mycosubtilin synthase subunit C Bacillus subtilis
P80435 8.85e-14 77 24 16 449 1 acmA 3-hydroxy-4-methylanthranilate adenylyltransferase Streptomyces anulatus
Q0S4D9 1.31e-13 76 23 11 367 1 casG Steroid-24-oyl-CoA synthetase Rhodococcus jostii (strain RHA1)
P0C062 1.33e-13 77 22 20 501 1 grsA Gramicidin S synthase 1 Brevibacillus brevis
Q8VYJ1 1.37e-13 76 22 13 466 1 AAE14 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal Arabidopsis thaliana
A0A7L9EYL1 1.56e-13 77 24 17 494 1 xenE Hybrid PKS-NRPS synthetase xenE Xenoacremonium sinensis
Q7XXL2 1.62e-13 76 25 14 364 2 4CLL9 4-coumarate--CoA ligase-like 9 Oryza sativa subsp. japonica
B2HI05 2.05e-13 75 22 18 516 3 fadD19 Medium/long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q67W82 2.07e-13 75 24 11 353 1 4CL4 4-coumarate--CoA ligase 4 Oryza sativa subsp. japonica
P0C061 2.5e-13 76 22 20 501 1 grsA Gramicidin S synthase 1 Aneurinibacillus migulanus
P0DUV3 2.58e-13 76 24 17 443 1 mpcA Malpicyclin synthetase Mortierella alpina
P0DUV3 1.35e-11 71 24 21 495 1 mpcA Malpicyclin synthetase Mortierella alpina
P0DUV3 5.81e-08 59 22 18 504 1 mpcA Malpicyclin synthetase Mortierella alpina
P0DUV3 8.58e-07 55 24 16 457 1 mpcA Malpicyclin synthetase Mortierella alpina
P0DUV3 3.46e-05 50 27 4 162 1 mpcA Malpicyclin synthetase Mortierella alpina
Q7WSH3 3.11e-13 75 23 20 506 3 fadD3 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase Comamonas testosteroni
Q9L9G0 3.26e-13 75 24 16 434 1 novH Novobiocin biosynthesis protein H Streptomyces niveus
Q4R4Z9 5.43e-13 74 25 11 322 2 ACSF2 Medium-chain acyl-CoA ligase ACSF2, mitochondrial Macaca fascicularis
P0DX84 6.08e-13 74 21 9 355 1 dmdB 3-methylmercaptopropionyl-CoA ligase Ruegeria lacuscaerulensis (strain DSM 11314 / KCTC 2953 / ITI-1157)
P31687 9.1e-13 73 22 13 463 2 None 4-coumarate--CoA ligase 2 Glycine max
Q8CT93 9.48e-13 73 22 15 440 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A2QTE5 9.97e-13 73 21 14 470 3 epaB Phenylacetyl-CoA ligase epaB Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
O68008 1.16e-12 74 23 16 490 3 bacC Bacitracin synthase 3 Bacillus licheniformis
O68008 6.58e-11 68 24 13 330 3 bacC Bacitracin synthase 3 Bacillus licheniformis
O68008 3.59e-10 66 22 17 472 3 bacC Bacitracin synthase 3 Bacillus licheniformis
O68008 1.27e-09 64 22 17 464 3 bacC Bacitracin synthase 3 Bacillus licheniformis
O68008 2.93e-09 63 23 23 505 3 bacC Bacitracin synthase 3 Bacillus licheniformis
P96843 1.17e-12 73 23 14 487 1 fadD3 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B2KWI3 1.23e-12 73 24 9 294 2 SID4 Acyl-CoA ligase SID4 Ajellomyces capsulatus
Q5R9G9 2.31e-12 72 24 11 322 2 ACSF2 Medium-chain acyl-CoA ligase ACSF2, mitochondrial Pongo abelii
Q6ZAC1 2.35e-12 72 24 14 455 1 4CL5 4-coumarate--CoA ligase 5 Oryza sativa subsp. japonica
Q84P26 2.96e-12 72 26 13 323 2 4CLL8 4-coumarate--CoA ligase-like 8 Arabidopsis thaliana
A0A319BQC1 3.39e-12 73 25 14 441 1 mlfA Malformin synthetase mlfA Aspergillus vadensis (strain CBS 113365 / IMI 142717 / IBT 24658)
Q84P25 3.44e-12 72 22 19 439 2 4CLL2 4-coumarate--CoA ligase-like 2 Arabidopsis thaliana
Q0P4F7 3.46e-12 72 23 12 351 2 acsf2 Medium-chain acyl-CoA ligase ACSF2, mitochondrial Danio rerio
B2HGV4 4.09e-12 72 25 11 320 3 fadD15 Long-chain-fatty-acid--CoA ligase FadD15 Mycobacterium marinum (strain ATCC BAA-535 / M)
P0C064 4.15e-12 72 22 20 495 1 grsB Gramicidin S synthase 2 Brevibacillus brevis
P0C064 1.4e-08 61 21 15 446 1 grsB Gramicidin S synthase 2 Brevibacillus brevis
P0C064 1.05e-07 58 20 13 446 1 grsB Gramicidin S synthase 2 Brevibacillus brevis
P0C064 3.11e-06 53 20 13 464 1 grsB Gramicidin S synthase 2 Brevibacillus brevis
S0EEY3 5.07e-12 72 23 18 439 1 FUS1 Fusarin C synthetase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P0C063 5.53e-12 72 22 20 495 1 grsB Gramicidin S synthase 2 Aneurinibacillus migulanus
P0C063 1.56e-07 58 21 14 437 1 grsB Gramicidin S synthase 2 Aneurinibacillus migulanus
P0C063 2.13e-07 57 20 13 448 1 grsB Gramicidin S synthase 2 Aneurinibacillus migulanus
P0C063 3.51e-06 53 20 13 464 1 grsB Gramicidin S synthase 2 Aneurinibacillus migulanus
P09095 5.76e-12 72 22 16 496 1 tycA Tyrocidine synthase 1 Brevibacillus parabrevis
O74976 7.55e-12 70 24 9 334 1 pcs60 Oxalate--CoA ligase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7TYX8 7.72e-12 71 25 11 320 3 fadD15 Long-chain-fatty-acid--CoA ligase FadD15 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A2I2F2N6 8.79e-12 71 22 14 448 1 cfoA Chalcone synthase cfoA Aspergillus candidus
S0EN43 1.03e-11 71 23 22 442 2 BEA1 Beauvericin nonribosomal cyclodepsipeptide synthetase BEA1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
C0LTL9 1.06e-11 70 28 4 206 1 sibE 3-hydroxy-4-methylanthranilate adenylyltransferase Streptosporangium sibiricum
A0A395I3F8 1.11e-11 71 25 15 443 1 BO97DRAFT_465346 Malformin synthetase mlfA Aspergillus homomorphus (strain CBS 101889)
A0A395I3F8 5.39e-05 50 26 6 208 1 BO97DRAFT_465346 Malformin synthetase mlfA Aspergillus homomorphus (strain CBS 101889)
Q96CM8 1.15e-11 70 24 12 323 1 ACSF2 Medium-chain acyl-CoA ligase ACSF2, mitochondrial Homo sapiens
D1FVF0 1.19e-11 71 24 17 432 1 BSLS Bassianolide nonribosomal cyclodepsipeptide synthetase Beauveria bassiana
Q26304 1.36e-11 70 25 10 305 1 None Luciferin 4-monooxygenase Luciola mingrelica
Q5HQN0 1.48e-11 70 22 21 517 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
E3UUE6 1.49e-11 70 20 14 532 1 fadD19 3-oxocholest-4-en-26-oate--CoA ligase Rhodococcus rhodochrous
J5JV76 1.49e-11 70 24 17 432 1 BSLS Bassianolide nonribosomal cyclodepsipeptide synthetase Beauveria bassiana (strain ARSEF 2860)
Q5ATG8 1.95e-11 70 24 18 422 1 apdA Hybrid PKS-NRPS synthetase apdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P41636 2.7e-11 69 22 11 375 2 4CL 4-coumarate--CoA ligase Pinus taeda
Q52400 3.07e-11 69 25 16 427 1 syrB1 Syringomycin synthase SyrB1 Pseudomonas syringae pv. syringae
B2VFS7 4.69e-11 68 26 10 287 3 aas Bifunctional protein Aas Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A0A2H5AIY4 4.77e-11 68 24 9 326 2 4CL2 4-coumarate-CoA ligase 2 Narcissus pseudonarcissus
Q84P23 4.9e-11 68 21 11 431 1 4CLL9 4-coumarate--CoA ligase-like 9 Arabidopsis thaliana
Q9X2N4 4.96e-11 68 22 13 422 3 dltA D-alanine--D-alanyl carrier protein ligase Staphylococcus xylosus
G3XMC0 5.81e-11 68 21 16 474 2 azaF Acyl-CoA ligase azaF Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q9AJS8 6.83e-11 68 24 16 432 1 hcl 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase Thauera aromatica
O53521 6.89e-11 68 25 11 320 1 fadD15 Long-chain-fatty-acid--CoA ligase FadD15 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q499N5 7.32e-11 68 22 16 502 2 Acsf2 Medium-chain acyl-CoA ligase ACSF2, mitochondrial Rattus norvegicus
A0A144KPJ6 7.68e-11 68 27 9 273 3 TES Nonribosomal peptide synthetase TES Alternaria alternata
A0A144KPJ6 6.22e-07 56 22 16 440 3 TES Nonribosomal peptide synthetase TES Alternaria alternata
A0A144KPJ6 2.09e-06 54 22 17 438 3 TES Nonribosomal peptide synthetase TES Alternaria alternata
Q69RG7 8.18e-11 67 21 12 440 2 4CLL7 4-coumarate--CoA ligase-like 7 Oryza sativa subsp. japonica
Q6Q883 1.04e-10 68 24 14 405 2 sirP Nonribosomal peptide synthetase sirP Leptosphaeria maculans
Q6Q883 0.000253 47 22 17 478 2 sirP Nonribosomal peptide synthetase sirP Leptosphaeria maculans
O68006 1.05e-10 68 23 21 496 3 bacA Bacitracin synthase 1 Bacillus licheniformis
O68006 5.83e-10 65 22 15 423 3 bacA Bacitracin synthase 1 Bacillus licheniformis
O68006 1.2e-08 61 22 20 499 3 bacA Bacitracin synthase 1 Bacillus licheniformis
O68006 1.46e-08 61 23 12 421 3 bacA Bacitracin synthase 1 Bacillus licheniformis
O68006 4.32e-05 50 20 14 452 3 bacA Bacitracin synthase 1 Bacillus licheniformis
P0C5B6 1.08e-10 67 21 17 442 2 4CLL4 OPC-6:CoA ligase Arabidopsis thaliana
B6D9A8 1.09e-10 68 23 19 469 1 Beas Beauvericin nonribosomal cyclodepsipeptide synthetase Beauveria bassiana
Q09164 1.09e-10 68 22 15 433 1 simA Cyclosporin synthetase simA Tolypocladium inflatum
Q09164 6.07e-10 65 22 18 482 1 simA Cyclosporin synthetase simA Tolypocladium inflatum
Q09164 1.86e-07 57 23 17 436 1 simA Cyclosporin synthetase simA Tolypocladium inflatum
Q09164 1.81e-06 54 21 16 444 1 simA Cyclosporin synthetase simA Tolypocladium inflatum
Q09164 9.14e-06 52 21 21 437 1 simA Cyclosporin synthetase simA Tolypocladium inflatum
Q09164 0.000186 48 22 17 436 1 simA Cyclosporin synthetase simA Tolypocladium inflatum
Q84P24 1.23e-10 67 24 11 356 1 4CLL6 4-coumarate--CoA ligase-like 6 Arabidopsis thaliana
Q9SMT7 1.32e-10 67 23 16 506 1 AAE3 Oxalate--CoA ligase Arabidopsis thaliana
A0A8F4S6Z6 1.38e-10 67 23 13 418 1 pydA Hybrid PKS-NRPS synthetase pydA Acremonium sp.
P9WEU9 1.47e-10 67 23 13 417 3 benZ Nonribisomal peptide synthetase benZ Aspergillus terreus
Q42524 1.49e-10 67 22 10 377 1 4CL1 4-coumarate--CoA ligase 1 Arabidopsis thaliana
P40806 1.63e-10 67 22 13 434 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P40806 1.43e-08 61 22 8 295 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
A0A098D1P1 1.99e-10 67 24 19 454 2 GRA1 Nonribosomal peptide synthetase GRA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A098D1P1 4.67e-07 56 23 7 298 2 GRA1 Nonribosomal peptide synthetase GRA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A098D1P1 2.16e-06 54 28 2 155 2 GRA1 Nonribosomal peptide synthetase GRA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A098D1P1 2.57e-05 50 22 12 414 2 GRA1 Nonribosomal peptide synthetase GRA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A098D1P1 0.000157 48 24 2 165 2 GRA1 Nonribosomal peptide synthetase GRA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9SEY5 2.18e-10 66 21 20 544 1 AAE2 Isovalerate--CoA ligase AAE2 Arabidopsis thaliana
Q5D6D7 2.95e-10 67 25 15 348 2 NPS2 Nonribosomal peptide synthetase 2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q5D6D7 0.001 45 21 21 508 2 NPS2 Nonribosomal peptide synthetase 2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
P9WEQ8 3.19e-10 65 26 12 312 3 olcI Nicotinic acid-CoA ligase olcI Penicillium canescens
Q17577 3.34e-10 65 24 9 303 1 acs-7 Acyl-CoA synthetase 7 Caenorhabditis elegans
Q4WR83 3.39e-10 65 24 9 297 2 sidI Acyl-CoA ligase sidI Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q0E7C4 3.59e-10 66 23 12 432 3 vabF Vanchrobactin synthase VabF Vibrio anguillarum
Q0E7C4 3.74e-05 50 20 20 527 3 vabF Vanchrobactin synthase VabF Vibrio anguillarum
O31782 4.1e-10 66 21 10 343 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
Q336M7 4.18e-10 65 27 12 317 3 4CLL2 4-coumarate--CoA ligase-like 2 Oryza sativa subsp. japonica
A4YDT1 4.46e-10 65 23 16 425 1 Msed_0406 4-hydroxybutyrate--CoA ligase 1 Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
A0A6J4B487 4.46e-10 66 22 15 434 3 LUC5 Hybrid PKS-NRPS synthetase LUC5 Fusarium sp.
K0E2F3 4.5e-10 65 26 10 310 1 ecdI Fatty-acyl-AMP ligase ecdI Aspergillus rugulosus
P0DJH0 4.56e-10 65 24 17 469 3 angR Anguibactin system regulator Vibrio anguillarum
Q6W4T3 4.89e-10 65 24 17 469 1 angR Anguibactin system regulator Vibrio anguillarum (strain ATCC 68554 / 775)
Q9LU36 5.31e-10 65 22 14 456 1 4CL4 4-coumarate--CoA ligase 4 Arabidopsis thaliana
P0DUV4 5.31e-10 65 23 15 434 1 mpbA Malpibaldin synthetase Mortierella alpina
P0DUV4 1.91e-09 64 23 20 511 1 mpbA Malpibaldin synthetase Mortierella alpina
P0DUV4 1.87e-07 57 25 2 152 1 mpbA Malpibaldin synthetase Mortierella alpina
P0DUV4 2.88e-06 53 27 3 154 1 mpbA Malpibaldin synthetase Mortierella alpina
P94547 5.62e-10 65 23 10 346 3 lcfA Long-chain-fatty-acid--CoA ligase Bacillus subtilis (strain 168)
Q01886 6.03e-10 65 23 15 434 1 HTS1 HC-toxin synthetase Cochliobolus carbonum
Q01886 1.21e-05 52 29 6 184 1 HTS1 HC-toxin synthetase Cochliobolus carbonum
Q01886 6.03e-05 49 27 7 183 1 HTS1 HC-toxin synthetase Cochliobolus carbonum
A0A3G9H9I5 6.46e-10 65 21 15 565 3 ALT10 Acyl-CoA synthetase ALT10 Alternaria alternata
A0A017SQ41 6.53e-10 65 23 18 389 3 echPS Nonribosomal peptide synthetase echPS Aspergillus ruber (strain CBS 135680)
P80436 6.96e-10 64 21 12 441 1 trsA Triostin synthetase I Streptomyces triostinicus
Q53005 7.88e-10 64 22 14 452 1 hbaA 4-hydroxybenzoate--CoA/benzoate--CoA ligase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P9WQ41 8.29e-10 64 25 15 383 1 mbtM Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0A4X9 8.29e-10 64 25 15 383 3 mbtM Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
F4HUK6 8.59e-10 64 22 19 520 1 AAE1 Butanoate--CoA ligase AAE1 Arabidopsis thaliana
P9WQ40 8.59e-10 64 25 15 383 3 mbtM Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0A319A6V2 9.2e-10 65 24 19 518 1 mlfA Malformin synthetase mlfA Aspergillus lacticoffeatus (strain CBS 101883)
A2QYX4 9.69e-10 65 24 19 518 1 mlfA Malformin synthetase mlfA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
G3XUF0 9.76e-10 65 24 19 518 1 mlfA Malformin synthetase mlfA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q7A1Q0 1.03e-09 63 20 14 476 3 vraA Putative long chain fatty acid-CoA ligase VraA Staphylococcus aureus (strain MW2)
Q6GBR2 1.03e-09 63 20 14 476 3 vraA Putative long chain fatty acid-CoA ligase VraA Staphylococcus aureus (strain MSSA476)
Q7A769 1.03e-09 63 20 14 476 3 vraA Putative long chain fatty acid-CoA ligase VraA Staphylococcus aureus (strain N315)
Q99W34 1.03e-09 63 20 14 476 3 vraA Putative long chain fatty acid-CoA ligase VraA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIA1 1.03e-09 63 20 14 476 3 vraA Putative long chain fatty acid-CoA ligase VraA Staphylococcus aureus (strain COL)
Q9KWK5 1.03e-09 63 20 14 476 3 vraA Putative long chain fatty acid-CoA ligase VraA Staphylococcus aureus (strain Mu3 / ATCC 700698)
G3J456 1.04e-09 65 24 14 448 1 cm3A Nonribosomal peptide synthetase cm3A Cordyceps militaris (strain CM01)
G3J456 2.06e-06 54 23 10 346 1 cm3A Nonribosomal peptide synthetase cm3A Cordyceps militaris (strain CM01)
P25464 1.06e-09 65 22 17 474 1 PCBAB N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Hapsidospora chrysogena
P25464 1.29e-07 58 22 17 462 1 PCBAB N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Hapsidospora chrysogena
P25464 0.000671 46 26 4 161 1 PCBAB N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Hapsidospora chrysogena
P27743 1.13e-09 65 25 20 455 3 pcbAB N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Amycolatopsis lactamdurans
A5JTM6 1.17e-09 64 24 14 353 1 None 4-chlorobenzoate--CoA ligase Pseudomonas sp. (strain CBS-3)
Q6GJ94 1.47e-09 63 21 15 471 3 vraA Putative long chain fatty acid-CoA ligase VraA Staphylococcus aureus (strain MRSA252)
C8VPS9 1.49e-09 64 26 13 316 3 easA Nonribosomal peptide synthetase easA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C8VPS9 1.29e-07 58 23 17 459 3 easA Nonribosomal peptide synthetase easA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C8VPS9 0.00039 47 23 15 439 3 easA Nonribosomal peptide synthetase easA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C8VPS9 0.000583 46 23 10 297 3 easA Nonribosomal peptide synthetase easA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
W7MLD7 1.56e-09 64 23 19 429 1 FUS1 Fusarin C synthetase Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A1L9NGU5 1.61e-09 64 24 17 519 1 mlfA Malformin synthetase mlfA Aspergillus tubingensis (strain CBS 134.48)
Q91VA0 2.07e-09 63 22 10 358 1 Acsm1 Acyl-coenzyme A synthetase ACSM1, mitochondrial Mus musculus
Q1IAK8 2.36e-09 63 22 14 454 1 pmsE Pseudomonine synthase PmsE Pseudomonas entomophila (strain L48)
Q80W40 2.56e-09 63 25 9 294 2 Acsm4 Acyl-coenzyme A synthetase ACSM4, mitochondrial Mus musculus
P31686 2.7e-09 61 24 7 266 2 None 4-coumarate--CoA ligase 1 (Fragment) Glycine max
P27206 2.87e-09 63 22 19 444 1 srfAA Surfactin synthase subunit 1 Bacillus subtilis (strain 168)
P27206 3.26e-06 53 23 17 441 1 srfAA Surfactin synthase subunit 1 Bacillus subtilis (strain 168)
P27206 0.000238 47 23 2 170 1 srfAA Surfactin synthase subunit 1 Bacillus subtilis (strain 168)
K3VAW3 3.47e-09 62 25 9 305 3 FPSE_09184 Acyl-CoA ligase FPSE_09184 Fusarium pseudograminearum (strain CS3096)
W7NDP3 3.52e-09 62 22 16 506 2 FVEG_12633 CoA ligase FVEG_12633 Gibberella moniliformis (strain M3125 / FGSC 7600)
F8J3D9 3.64e-09 62 27 13 309 1 tmlU Marinolic acid--CoA ligase Pseudoalteromonas sp. (strain SANK 73390)
Q08AH1 3.88e-09 62 24 13 358 1 ACSM1 Acyl-coenzyme A synthetase ACSM1, mitochondrial Homo sapiens
Q53FZ2 4.43e-09 62 22 14 359 1 ACSM3 Acyl-coenzyme A synthetase ACSM3, mitochondrial Homo sapiens
Q17QJ1 4.61e-09 62 22 10 323 2 ACSF2 Medium-chain acyl-CoA ligase ACSF2, mitochondrial Bos taurus
Q5REV5 4.83e-09 62 22 14 359 2 ACSM3 Acyl-coenzyme A synthetase ACSM3, mitochondrial Pongo abelii
Q9BEA2 5.04e-09 62 22 12 355 1 ACSM1 Acyl-coenzyme A synthetase ACSM1, mitochondrial Bos taurus
Q7TN78 5.15e-09 62 26 11 292 1 Acsm4 Acyl-coenzyme A synthetase ACSM4, mitochondrial Rattus norvegicus
Q8VCW8 6.04e-09 62 23 12 324 1 Acsf2 Medium-chain acyl-CoA ligase ACSF2, mitochondrial Mus musculus
G3GBU7 6.17e-09 62 21 16 421 3 None Beauvericin nonribosomal cyclodepsipeptide synthetase BEA1 Gibberella intermedia
Q4WZ44 6.91e-09 62 23 15 429 3 NRPS7 Nonribosomal peptide synthetase 7 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WZ44 8.56e-07 55 23 19 489 3 NRPS7 Nonribosomal peptide synthetase 7 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A0H2ZGB9 7.07e-09 62 26 16 427 1 pchE Pyochelin synthase PchE Pseudomonas aeruginosa (strain UCBPP-PA14)
G3XCV2 7.19e-09 62 26 16 427 1 pchE Pyochelin synthase PchE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A348AXX4 7.72e-09 62 23 22 511 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
A0A348AXX4 1.04e-08 62 22 11 414 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
A0A348AXX4 1.04e-08 62 22 11 414 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
A0A348AXX4 4.8e-08 59 21 12 417 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
A0A348AXX4 5.09e-06 53 21 20 521 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
A0A348AXX4 7.55e-06 52 22 18 433 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
A0A348AXX4 1.27e-05 52 21 11 415 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
A0A348AXX4 2.66e-05 50 20 16 458 1 kk1B Nonribosomal peptide synthetase kk1B Curvularia clavata
P19409 8.48e-09 61 21 15 485 1 baiB Bile acid--coenzyme A ligase Clostridium scindens (strain JCM 10418 / VPI 12708)
B6F209 8.64e-09 62 23 19 506 1 cpaA Cyclo-acetoacetyl-L-tryptophan synthase Aspergillus oryzae
I1S2J4 8.78e-09 61 26 8 259 1 NRPS9 Nonribosomal peptide synthetase 9 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
S3DB78 8.89e-09 61 25 10 317 1 gloD Acyl-CoA ligase gloD Glarea lozoyensis (strain ATCC 20868 / MF5171)
Q3E6Y4 9.35e-09 61 21 11 355 2 4CLL3 4-coumarate--CoA ligase-like 3 Arabidopsis thaliana
A9N3H8 9.71e-09 61 26 12 292 3 aas Bifunctional protein Aas Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q8ZMA4 1.01e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6TDH2 1.01e-08 61 27 11 292 3 aas Bifunctional protein Aas Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4T503 1.03e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella newport (strain SL254)
B4TGR5 1.05e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella heidelberg (strain SL476)
B5QWU2 1.05e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella enteritidis PT4 (strain P125109)
B5FUB9 1.05e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella dublin (strain CT_02021853)
B5RDY6 1.06e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5F4V4 1.06e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella agona (strain SL483)
E9FCP4 1.08e-08 62 21 12 436 1 dtxS1 Nonribosomal peptide synthetase dtxS1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
E9FCP4 1.72e-05 51 26 4 185 1 dtxS1 Nonribosomal peptide synthetase dtxS1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
E9FCP4 3.29e-05 50 26 5 180 1 dtxS1 Nonribosomal peptide synthetase dtxS1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
E9FCP4 0.000115 48 28 3 153 1 dtxS1 Nonribosomal peptide synthetase dtxS1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q8Z406 1.09e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella typhi
B4TUM9 1.11e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella schwarzengrund (strain CVM19633)
B5BFH6 1.19e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella paratyphi A (strain AKU_12601)
Q5PEN7 1.19e-08 61 26 12 292 3 aas Bifunctional protein Aas Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A0A8F4S8Q3 1.22e-08 61 23 16 428 1 gkaA Hybrid PKS-NRPS synthetase gkaA Penicillium citrinum
A4TLD3 1.34e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pestis (strain Pestoides F)
A9R2S1 1.34e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pestis bv. Antiqua (strain Angola)
C0PXJ8 1.38e-08 60 26 12 292 3 aas Bifunctional protein Aas Salmonella paratyphi C (strain RKS4594)
Q57KA7 1.38e-08 60 26 12 292 3 aas Bifunctional protein Aas Salmonella choleraesuis (strain SC-B67)
Q74RZ6 1.39e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pestis
Q1CAS8 1.39e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pestis bv. Antiqua (strain Antiqua)
B1JQC1 1.4e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667F1 1.4e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pseudotuberculosis serotype I (strain IP32953)
B2JZ75 1.4e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFD1 1.4e-08 60 25 9 268 3 aas Bifunctional protein Aas Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q1R7H5 1.53e-08 60 26 10 285 3 aas Bifunctional protein Aas Escherichia coli (strain UTI89 / UPEC)
A1AF47 1.53e-08 60 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O1:K1 / APEC
B7MLI2 1.53e-08 60 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TDZ6 1.57e-08 60 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P08659 1.6e-08 60 25 12 300 1 None Luciferin 4-monooxygenase Photinus pyralis
Q4WMJ7 2.12e-08 60 21 11 497 1 gliP Nonribosomal peptide synthetase gliP Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WMJ7 0.00014 48 20 17 440 1 gliP Nonribosomal peptide synthetase gliP Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q81T97 2.27e-08 60 21 10 439 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus anthracis
C3LAH8 2.27e-08 60 21 10 439 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P4I7 2.27e-08 60 21 10 439 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus anthracis (strain A0248)
B5XUP2 2.44e-08 60 27 11 286 3 aas Bifunctional protein Aas Klebsiella pneumoniae (strain 342)
A7GMR0 2.52e-08 59 23 10 441 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A1JPF0 2.55e-08 60 26 10 269 3 aas Bifunctional protein Aas Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
I1SAJ7 2.95e-08 60 26 7 282 1 NRPS5 Nonribosomal peptide synthetase 5 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
I1SAJ7 1.6e-05 51 28 4 156 1 NRPS5 Nonribosomal peptide synthetase 5 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
I1SAJ7 4.07e-05 50 23 13 438 1 NRPS5 Nonribosomal peptide synthetase 5 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9LQ12 3.06e-08 59 24 12 311 1 4CLL1 4-coumarate--CoA ligase-like 1 Arabidopsis thaliana
B9IUW2 3.11e-08 59 22 12 442 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain Q1)
D4AU56 3.42e-08 60 24 16 417 2 sidC Nonribosomal peptide synthase sidC Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
D4AU56 4.54e-05 50 25 16 404 2 sidC Nonribosomal peptide synthase sidC Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
A0A166YZW0 4.31e-08 59 29 8 215 1 ppzA Peramine synthetase ppzA Metarhizium rileyi (strain RCEF 4871)
A0A166YZW0 0.000182 48 26 4 171 1 ppzA Peramine synthetase ppzA Metarhizium rileyi (strain RCEF 4871)
Q5AUZ6 5.16e-08 59 27 3 177 2 atnA Nonribosomal peptide synthase atnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5AUZ6 1.92e-06 54 22 13 412 2 atnA Nonribosomal peptide synthase atnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5AUZ6 0.000483 47 24 4 167 2 atnA Nonribosomal peptide synthase atnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A8AP56 5.35e-08 59 26 12 292 3 aas Bifunctional protein Aas Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7HK95 5.55e-08 58 23 13 444 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain AH187)
A7MR36 5.88e-08 58 25 9 285 3 aas Bifunctional protein Aas Cronobacter sakazakii (strain ATCC BAA-894)
Q81G39 6.11e-08 58 22 11 440 1 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HHC6 6.11e-08 58 22 11 440 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain B4264)
B7N768 6.31e-08 58 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0C7M7 6.84e-08 58 24 10 297 1 ACSM4 Acyl-coenzyme A synthetase ACSM4, mitochondrial Homo sapiens
O07619 7.25e-08 58 21 13 489 2 yhfT Uncharacterized acyl--CoA ligase YhfT Bacillus subtilis (strain 168)
C6DE43 7.33e-08 58 26 11 268 3 aas Bifunctional protein Aas Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q4WVN4 7.7e-08 58 28 2 159 3 NRPS8 Nonribosomal peptide synthetase 8 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WVN4 2.89e-06 53 23 10 362 3 NRPS8 Nonribosomal peptide synthetase 8 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WVN4 3.64e-06 53 23 8 320 3 NRPS8 Nonribosomal peptide synthetase 8 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q27757 7.7e-08 58 21 15 443 2 None Luciferin 4-monooxygenase Photuris pensylvanica
P40871 8.05e-08 58 21 19 499 1 dhbE 2,3-dihydroxybenzoate-AMP ligase Bacillus subtilis (strain 168)
Q6HLH7 8.17e-08 58 22 11 440 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1EM80 8.17e-08 58 22 11 440 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain 03BB102)
B7JFV5 8.17e-08 58 22 11 440 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain AH820)
A0RBJ0 8.17e-08 58 22 11 440 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus thuringiensis (strain Al Hakam)
Q84HC5 9.23e-08 58 23 11 347 1 ncsB2 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase Streptomyces carzinostaticus
Q6D107 9.51e-08 58 26 11 268 3 aas Bifunctional protein Aas Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0A0C1E5J8 1.03e-07 58 21 10 415 1 opaA Nonribosomal peptide synthetase opaA Aspergillus ustus
A0A2I2F262 1.08e-07 58 21 14 441 1 acdB PKS-NRPS hybrid synthetase acdB Aspergillus candidus
Q4KCY5 1.08e-07 57 22 14 429 1 pltF L-proline--[L-prolyl-carrier protein] ligase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B7LNJ2 1.16e-07 58 26 10 285 3 aas Bifunctional protein Aas Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8ALR6 1.22e-07 57 21 15 449 3 caiC Crotonobetaine/carnitine--CoA ligase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q01158 1.25e-07 57 24 9 297 2 None Luciferin 4-monooxygenase Aquatica lateralis
Q63E02 1.28e-07 57 22 12 442 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain ZK / E33L)
B1LR34 1.32e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli (strain SMS-3-5 / SECEC)
Q73BD2 1.33e-07 57 22 12 442 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain ATCC 10987 / NRS 248)
A9MQH7 1.33e-07 57 21 17 510 3 caiC Crotonobetaine/carnitine--CoA ligase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9LK39 1.38e-07 57 25 17 348 2 AAE16 Probable acyl-activating enzyme 16, chloroplastic Arabidopsis thaliana
B5Z4F4 1.44e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X6J8 1.44e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O157:H7
O31827 1.46e-07 58 25 5 180 1 ppsE Plipastatin synthase subunit E Bacillus subtilis (strain 168)
Q3YY21 1.48e-07 57 26 10 285 3 aas Bifunctional protein Aas Shigella sonnei (strain Ss046)
B6I6W1 1.48e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli (strain SE11)
B7LF13 1.48e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli (strain 55989 / EAEC)
D9XF49 1.52e-07 57 23 16 506 1 phsB Phosphinothricin tripeptide synthase PhsB Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)
A0A0S6XHH0 1.52e-07 58 22 15 443 1 frbI FR901469 synthetase Fungal sp. (strain No.11243)
A0A0S6XHH0 7.91e-05 49 21 18 517 1 frbI FR901469 synthetase Fungal sp. (strain No.11243)
A0A0S6XHH0 0.000581 46 27 4 159 1 frbI FR901469 synthetase Fungal sp. (strain No.11243)
A0A0S6XHH0 0.000644 46 26 2 155 1 frbI FR901469 synthetase Fungal sp. (strain No.11243)
A0A0S6XHH0 0.000738 46 27 7 177 1 frbI FR901469 synthetase Fungal sp. (strain No.11243)
P31119 1.58e-07 57 26 10 285 1 aas Bifunctional protein Aas Escherichia coli (strain K12)
B1XDP2 1.58e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli (strain K12 / DH10B)
C4ZZY9 1.58e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli (strain K12 / MC4100 / BW2952)
P69451 1.59e-07 57 25 15 359 1 fadD Long-chain-fatty-acid--CoA ligase Escherichia coli (strain K12)
P69452 1.59e-07 57 25 15 359 3 fadD Long-chain-fatty-acid--CoA ligase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1IU08 1.63e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A3X0 1.63e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O9:H4 (strain HS)
A7ZQU2 1.63e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O139:H28 (strain E24377A / ETEC)
G2Q9A5 1.65e-07 58 23 18 442 1 mycA Hybrid PKS-NRPS synthetase mycA Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)
C8VTR6 1.66e-07 57 26 11 291 3 AN10074 Putative acyl-coenzyme A synthetase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A317VEE1 1.67e-07 58 24 14 412 1 mlfA Malformin synthetase mlfA Aspergillus eucalypticola (strain CBS 122712 / IBT 29274)
B2TYQ5 1.7e-07 57 26 10 285 3 aas Bifunctional protein Aas Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P27742 1.7e-07 57 22 18 492 1 acvA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P27742 7.72e-06 52 26 6 159 1 acvA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P27742 0.000359 47 23 4 164 1 acvA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q83JV7 1.81e-07 57 26 10 285 3 aas Bifunctional protein Aas Shigella flexneri
Q0T128 1.81e-07 57 26 10 285 3 aas Bifunctional protein Aas Shigella flexneri serotype 5b (strain 8401)
B7IN64 1.84e-07 57 22 11 440 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus cereus (strain G9842)
A0A1L9U7P9 1.9e-07 57 23 12 414 1 mlfA Malformin synthetase mlfA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
A0A1L9U7P9 2.83e-05 50 28 3 156 1 mlfA Malformin synthetase mlfA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
P29698 2.01e-07 57 23 16 430 3 entF Enterobactin synthase component F Shigella flexneri
Q6NUN0 2.16e-07 57 26 11 264 1 ACSM5 Acyl-coenzyme A synthetase ACSM5, mitochondrial Homo sapiens
B7NVY2 2.22e-07 57 26 10 285 3 aas Bifunctional protein Aas Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8FEA6 2.32e-07 57 26 10 267 3 aas Bifunctional protein Aas Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UHQ4 2.32e-07 57 26 10 267 3 aas Bifunctional protein Aas Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P46450 2.38e-07 57 23 13 348 3 fadD Long-chain-fatty-acid--CoA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4WLW5 2.62e-07 57 24 7 310 1 fmqA Nonribosomal peptide synthetase fmqA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WLW5 2.62e-05 50 28 3 164 1 fmqA Nonribosomal peptide synthetase fmqA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q68CK6 2.71e-07 56 25 11 305 1 ACSM2B Acyl-coenzyme A synthetase ACSM2B, mitochondrial Homo sapiens
A4WE11 2.72e-07 57 25 9 282 3 aas Bifunctional protein Aas Enterobacter sp. (strain 638)
P13129 3.1e-07 56 24 11 298 1 None Luciferin 4-monooxygenase Nipponoluciola cruciata
Q8XDR6 3.14e-07 56 24 15 359 3 fadD Long-chain-fatty-acid--CoA ligase Escherichia coli O157:H7
Q10896 3.26e-07 57 24 15 425 1 nrp Isonitrile lipopeptide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I1RF49 3.4e-07 57 22 20 528 1 NRPS4 Nonribosomal peptide synthetase 4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
I1RF49 7.75e-07 55 21 14 455 1 NRPS4 Nonribosomal peptide synthetase 4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
I1RF49 3.94e-05 50 26 6 167 1 NRPS4 Nonribosomal peptide synthetase 4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
I1RF49 7e-05 49 27 3 159 1 NRPS4 Nonribosomal peptide synthetase 4 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
B7L4G0 3.4e-07 56 20 17 515 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain 55989 / EAEC)
O53551 3.45e-07 56 21 9 287 1 fadD17 Medium/long-chain-fatty-acid--CoA ligase FadD17 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TWC5 3.45e-07 56 21 9 287 3 fadD17 Medium/long-chain-fatty-acid--CoA ligase FadD17 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B7M0D4 3.65e-07 56 20 17 514 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O8 (strain IAI1)
Q4WF61 3.77e-07 56 24 11 312 2 NRPS3 Nonribosomal peptide synthase sidE Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A7ZVY7 4.23e-07 55 20 17 515 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O9:H4 (strain HS)
Q08AH3 4.26e-07 56 24 12 320 1 ACSM2A Acyl-coenzyme A synthetase ACSM2A, mitochondrial Homo sapiens
B6HYY8 4.54e-07 55 21 19 515 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain SE11)
A0A179HJB8 4.97e-07 55 25 7 206 2 lcsD Acyl-CoA ligase lcsD Purpureocillium lilacinum
A7ZHC8 5.5e-07 55 20 16 515 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O139:H28 (strain E24377A / ETEC)
K3VDP2 5.52e-07 56 24 23 468 3 NRPS32 Nonribosomal peptide synthetase 32 Fusarium pseudograminearum (strain CS3096)
K3VDP2 8.31e-06 52 31 4 175 3 NRPS32 Nonribosomal peptide synthetase 32 Fusarium pseudograminearum (strain CS3096)
K3VDP2 1.27e-05 52 22 13 456 3 NRPS32 Nonribosomal peptide synthetase 32 Fusarium pseudograminearum (strain CS3096)
P9WEV1 5.72e-07 56 21 15 418 3 valB Nonribisomal peptide synthetase valB Aspergillus terreus
Q8J2R0 5.99e-07 55 23 9 347 3 FUM10 Acyl-CoA synthetase FUM10 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A1W6BT53 6.01e-07 56 23 3 173 1 apmA N-benzoylphenylalaninol synthetase apmA Penicillium brevicompactum
O07899 6.31e-07 55 21 15 495 3 vibE Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P11454 7.49e-07 55 23 16 430 1 entF Enterobactin synthase component F Escherichia coli (strain K12)
A0A2V5H0B0 7.8e-07 55 25 22 436 3 ungA Nonribosomal peptide synthetase ungA Aspergillus violaceofuscus (strain CBS 115571)
A0A2V5H0B0 0.000167 48 26 4 176 3 ungA Nonribosomal peptide synthetase ungA Aspergillus violaceofuscus (strain CBS 115571)
Q9C9G2 8.12e-07 55 20 18 535 3 AEE22 Probable acyl-activating enzyme 22 Arabidopsis thaliana
Q8W471 9.44e-07 55 23 7 266 1 AAE15 Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic Arabidopsis thaliana
Q3Z5X2 1.04e-06 54 20 17 514 3 caiC Crotonobetaine/carnitine--CoA ligase Shigella sonnei (strain Ss046)
G7XQ31 1.05e-06 55 24 15 414 1 mlfA Malformin synthetase mlfA Aspergillus kawachii (strain NBRC 4308)
S7Z800 1.15e-06 55 24 16 431 3 opdA Hybrid PKS-NRPs synthetase opdA Penicillium oxalicum (strain 114-2 / CGMCC 5302)
Q1BBA2 1.16e-06 54 24 9 328 3 mbtM Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM Mycobacterium sp. (strain MCS)
B7LWM8 1.27e-06 54 20 16 515 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q9P7T1 1.28e-06 55 23 18 431 1 sib1 Hydroxamate-type ferrichrome siderophore peptide synthetase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4WLD5 1.36e-06 54 22 14 370 1 pyr1 Nicotinic acid-CoA ligase pyr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B8NY88 1.49e-06 55 24 20 435 1 agiA Nonribosomal peptide synthase agiA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A9VKV6 1.49e-06 54 22 12 442 3 dltA D-alanine--D-alanyl carrier protein ligase Bacillus mycoides (strain KBAB4)
Q4WYG2 1.64e-06 54 23 13 397 3 NRPS5 Nonribosomal peptide synthetase 5 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WYG2 8.38e-06 52 22 21 497 3 NRPS5 Nonribosomal peptide synthetase 5 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q8PDW6 1.68e-06 54 21 20 526 1 oleC Olefin beta-lactone synthetase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B7UI83 1.71e-06 53 21 18 454 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q6TNA5 1.89e-06 53 23 15 425 1 CmaA L-allo-isoleucine:holo-[CmaA peptidyl-carrier protein] ligase Pseudomonas savastanoi pv. glycinea
I1RN14 2.07e-06 54 24 20 463 2 NPS2 Nonribosomal peptide synthetase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q73ZP7 2.14e-06 53 23 8 318 3 mbtM Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q6YYZ2 2.16e-06 53 27 14 307 3 4CLL3 4-coumarate--CoA ligase-like 3 Oryza sativa subsp. japonica
M1W5Z4 2.33e-06 54 24 17 436 3 lpsA2 D-lysergyl-peptide-synthetase subunit 1 Claviceps purpurea (strain 20.1)
B5YYD1 2.56e-06 53 20 15 513 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA34 2.56e-06 53 20 15 513 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O157:H7
B1LFX0 2.63e-06 53 20 17 515 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain SMS-3-5 / SECEC)
P44446 2.72e-06 53 27 5 218 3 HI_0002 Putative long-chain-fatty-acid--CoA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7N7A9 2.81e-06 53 26 13 265 3 aas Bifunctional protein Aas Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A0A318Z3U0 2.87e-06 53 25 16 413 1 mlfA Malformin synthetase mlfA Aspergillus neoniger (strain CBS 115656)
B4EY25 3.05e-06 53 20 15 511 3 caiC Crotonobetaine/carnitine--CoA ligase Proteus mirabilis (strain HI4320)
A0QUA1 3.27e-06 53 22 15 450 1 mbtM Medium/long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9SFW5 3.43e-06 53 20 14 461 3 AEE21 Probable acyl-activating enzyme 21 Arabidopsis thaliana
Q4WT66 4.04e-06 53 24 8 293 1 NRPS1 Nonribosomal peptide synthetase 1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WT66 0.000714 46 22 16 422 1 NRPS1 Nonribosomal peptide synthetase 1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B7MNP4 4.93e-06 52 20 16 514 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O81 (strain ED1a)
Q2UPA9 5.17e-06 53 21 15 422 1 aclP Nonribosomal peptide synthetase aclP Aspergillus oryzae (strain ATCC 42149 / RIB 40)
S0DLP2 5.23e-06 53 22 15 413 1 apf1 Apicidin F synthase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S0DLP2 8.83e-06 52 23 18 428 1 apf1 Apicidin F synthase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S0DLP2 1.78e-05 51 29 3 172 1 apf1 Apicidin F synthase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S0DLP2 2.88e-05 50 25 3 168 1 apf1 Apicidin F synthase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q5BDY8 6.04e-06 53 25 1 176 3 nlsA Nonribosomal peptide synthase nlsA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BDY8 0.000485 47 25 3 178 3 nlsA Nonribosomal peptide synthase nlsA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B7NHE1 6.13e-06 52 20 17 514 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83MG9 6.63e-06 52 20 15 515 3 caiC Crotonobetaine/carnitine--CoA ligase Shigella flexneri
A0A024F9J0 6.64e-06 52 25 19 382 3 vlmC AMP-dependent ligase vlmC Lecanicillium sp.
P9WEU8 7.46e-06 52 22 14 439 3 benY Nonribisomal peptide synthetase benY Aspergillus terreus
O06417 7.83e-06 52 26 11 251 1 fadD8 Medium/long-chain-fatty-acid--CoA ligase FadD8 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q3UNX5 8.1e-06 52 22 13 359 1 Acsm3 Acyl-coenzyme A synthetase ACSM3, mitochondrial Mus musculus
A0A1U8QWA2 8.2e-06 52 22 13 430 1 ATRR Glycine betaine reductase ATRR Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8K0L3 8.36e-06 52 24 15 307 1 Acsm2 Acyl-coenzyme A synthetase ACSM2, mitochondrial Mus musculus
A0A1M3T4K3 9.06e-06 52 25 15 389 1 mlfA Malformin synthetase mlfA Aspergillus luchuensis (strain CBS 106.47)
Q55DR6 1.1e-05 51 26 8 213 1 fcsA Fatty acyl-CoA synthetase A Dictyostelium discoideum
P54200 1.12e-05 51 24 26 507 3 fadD21 Putative fatty-acid--CoA ligase fadD21 Mycobacterium leprae (strain TN)
O14975 1.13e-05 51 28 8 194 1 SLC27A2 Long-chain fatty acid transport protein 2 Homo sapiens
B1IRD9 1.18e-05 51 19 14 514 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A0A0U1LQE6 1.23e-05 52 22 9 323 3 cctN Cyclochlorotine synthetase Talaromyces islandicus
A0A0U1LQE6 4.22e-05 50 25 5 237 3 cctN Cyclochlorotine synthetase Talaromyces islandicus
A8NVB7 1.24e-05 51 27 7 218 1 CC1G_06235 Adenylate-forming reductase 06235 Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)
B0CN26 1.24e-05 51 23 17 435 1 sfmB Nonribosomal peptide synthase SfmB Streptomyces lavendulae
A0JJU1 1.28e-05 52 24 12 380 1 tenS Tenellin synthetase Beauveria bassiana
B6HLU1 1.57e-05 51 22 15 445 1 acvA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
B6HLU1 0.000149 48 20 20 501 1 acvA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
P19787 1.57e-05 51 22 15 445 1 acvA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Penicillium chrysogenum
P19787 0.000149 48 20 20 501 1 acvA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Penicillium chrysogenum
Q96V34 1.68e-05 51 27 2 172 3 lpsA D-lysergyl-peptide-synthetase subunit 1 Epichloe festucae var. lolii
A0A5K6CNB8 1.72e-05 51 24 13 425 1 posA Delta-poly-L-ornithine synthetase Acinetobacter baumannii (strain AB307-0294)
A0A024F910 1.75e-05 51 25 9 298 3 vlmS Nonribosomal peptide synthetase vlms Lecanicillium sp.
A0A024F910 1.88e-05 51 24 19 480 3 vlmS Nonribosomal peptide synthetase vlms Lecanicillium sp.
Q1RGG1 1.84e-05 50 20 17 513 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain UTI89 / UPEC)
A1A787 1.84e-05 50 20 17 513 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli O1:K1 / APEC
P9WQ49 2.2e-05 50 33 7 145 1 fadD21 Putative fatty-acid--CoA ligase FadD21 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ48 2.2e-05 50 33 7 145 3 fadD21 Putative fatty-acid--CoA ligase fadD21 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63524 2.2e-05 50 33 7 145 3 fadD21 Putative fatty-acid--CoA ligase fadD21 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8BGA8 3.83e-05 50 25 11 262 1 Acsm5 Acyl-coenzyme A synthetase ACSM5, mitochondrial Mus musculus
Q6SKG1 3.94e-05 49 21 8 252 2 Acsm3 Acyl-coenzyme A synthetase ACSM3, mitochondrial Rattus norvegicus
P31552 4.88e-05 49 19 14 514 1 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain K12)
B1XBG2 4.88e-05 49 19 14 514 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain K12 / DH10B)
C4ZPW3 4.88e-05 49 19 14 514 3 caiC Crotonobetaine/carnitine--CoA ligase Escherichia coli (strain K12 / MC4100 / BW2952)
O05307 4.96e-05 49 26 3 185 1 fadD6 Medium/long-chain-fatty-acid--CoA ligase FadD6 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I1RVD9 5.36e-05 50 22 20 519 3 NRPS7 Nonribosomal peptide synthetase 7 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
O88813 5.41e-05 49 23 12 324 1 Acsl5 Long-chain-fatty-acid--CoA ligase 5 Rattus norvegicus
Q5BA81 5.81e-05 49 23 7 303 3 easD Acyl-CoA ligase easD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
O70490 5.99e-05 49 25 13 294 2 Acsm2 Acyl-coenzyme A synthetase ACSM2, mitochondrial Rattus norvegicus
Q5B7I5 7.35e-05 49 21 15 416 2 inpA Nonribosomal peptide synthase inpA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B8NTZ9 8.08e-05 48 26 8 222 2 lnaA Aldehyde reductase lnaA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
Q8GB18 8.3e-05 48 20 17 514 3 caiC Crotonobetaine/carnitine--CoA ligase Proteus sp. (strain LE138)
G3J455 9.68e-05 48 23 12 318 1 cm3C Acyl-CoA ligase cm3C Cordyceps militaris (strain CM01)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08545
Feature type CDS
Gene menE
Product o-succinylbenzoate--CoA ligase
Location 1863524 - 1864948 (strand: -1)
Length 1425 (nucleotides) / 474 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1881
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00501 AMP-binding enzyme

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0318 Lipid transport and metabolism (I) I O-succinylbenzoic acid-CoA ligase MenE or related acyl-CoA synthetase (AMP-forming)

Kegg Ortholog Annotation(s)

Protein Sequence

MATVVNFTQWPWHHWAQLNPNETAIISGDSPITWQQLSCHINRLANHLAKQGVNTKSTVLLRGKNHIHVVFTLLAVFQCGAKVLPLDPQLPKSLLDDLLPHLNIDFYADLSGSTLELDARLLDLSGVEFNNKSHQDKNNMAGVAWASSRMATLILTSGSSGLPKAAVHTFQAHLCSAEGVLELIPFEKSDSWLLSLPLFHVSGQGILWRWLLRGATLVVRNMHPFIAALQGCTHASLVPTQLWRLLQNTQQDSSQPITLKAVLLGGAMIPTELTQCAESKGIQCWCGYGMTEMASTVCAKRADGKAGVGTPLKGKAVRLVDNEIQIKSDSVALGYWFDGQLKPLSQTQDDWYATRDRGCFKEGEWCILGRLDNLFFSAGEGIQPEDIEKVLNSHPNVRQTFIVPIDDIEFGQRPVAVVDTDIETINQLPQWYHTRLAGFQRPIACLLLPEQLKNGGIKISRKQVQQWVKGQQVN

Flanking regions ( +/- flanking 50bp)

TGGCCAGATGTAGATATTCCGCTTATTACGCTTGAACAGCTTAAGACAGTATGGCAACAGTAGTTAATTTTACACAATGGCCGTGGCATCACTGGGCGCAGCTTAACCCAAATGAAACGGCCATCATATCCGGTGATTCACCTATAACATGGCAACAATTAAGTTGTCATATCAATCGATTGGCGAACCATTTAGCAAAACAGGGTGTTAATACTAAAAGTACCGTGTTGCTACGTGGTAAAAATCATATTCATGTTGTTTTTACTCTACTTGCTGTTTTTCAATGCGGTGCAAAAGTATTACCGTTAGATCCTCAGCTCCCTAAGTCTCTACTTGATGATTTATTACCCCATTTAAACATCGATTTTTATGCTGATTTAAGTGGATCAACACTTGAGTTAGATGCGAGGTTACTCGATCTTTCAGGTGTCGAATTCAATAACAAATCACATCAAGATAAAAATAACATGGCAGGTGTTGCATGGGCATCTTCTCGTATGGCAACACTGATCTTAACCTCTGGATCATCAGGTCTACCTAAAGCCGCTGTGCATACTTTTCAAGCTCATCTTTGTAGTGCAGAAGGTGTTCTTGAATTGATACCCTTTGAAAAAAGCGACAGTTGGTTATTGTCTTTACCTCTCTTTCATGTATCTGGGCAAGGAATTCTTTGGCGTTGGTTATTACGAGGCGCTACCTTGGTAGTGCGTAATATGCACCCCTTTATTGCTGCTTTGCAAGGCTGTACTCATGCTTCTTTAGTGCCAACGCAACTTTGGCGTTTATTACAAAATACACAACAGGATAGTTCGCAGCCCATCACATTAAAAGCTGTTTTATTAGGGGGAGCGATGATCCCAACTGAATTAACCCAATGTGCGGAAAGTAAAGGTATTCAGTGTTGGTGTGGTTATGGCATGACTGAAATGGCCTCTACTGTTTGTGCAAAACGCGCAGATGGTAAAGCGGGAGTTGGTACGCCATTAAAGGGTAAAGCGGTCAGATTAGTGGATAATGAAATCCAGATCAAATCTGATAGTGTTGCATTAGGATATTGGTTTGATGGTCAATTAAAGCCGTTATCACAGACTCAGGATGATTGGTATGCAACACGGGATAGAGGTTGTTTTAAAGAGGGGGAATGGTGCATTTTAGGGCGATTAGATAATCTGTTTTTTAGTGCGGGTGAAGGTATACAGCCAGAAGATATTGAAAAGGTGCTAAATAGTCACCCGAATGTTCGCCAAACATTTATTGTCCCGATTGACGATATTGAATTTGGTCAACGTCCCGTTGCTGTTGTTGATACTGATATTGAGACAATTAATCAATTACCACAATGGTATCATACGCGTTTAGCAGGCTTTCAACGTCCCATCGCTTGTTTACTATTACCAGAACAGCTAAAGAATGGAGGGATCAAAATCTCTCGTAAACAAGTGCAACAGTGGGTGAAAGGGCAACAAGTAAATTGATATTGCGATTTTATCGAACGACTTTAAGAAAGGCGCCCAAACTACAGGCG