Homologs in group_481

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00770 FBDBKF_00770 65.7 Morganella morganii S1 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
EHELCC_00775 EHELCC_00775 65.7 Morganella morganii S2 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
NLDBIP_02685 NLDBIP_02685 65.7 Morganella morganii S4 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
LHKJJB_04200 LHKJJB_04200 65.7 Morganella morganii S3 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
HKOGLL_02845 HKOGLL_02845 65.7 Morganella morganii S5 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
F4V73_RS06770 F4V73_RS06770 65.1 Morganella psychrotolerans - chemotaxis response regulator protein-glutamate methylesterase

Distribution of the homologs in the orthogroup group_481

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_481

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N5T1 0.0 582 79 0 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D6I7 0.0 561 76 0 350 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1RAQ1 0.0 556 76 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain UTI89 / UPEC)
Q0TGV0 0.0 556 76 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z2R1 0.0 555 76 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella sonnei (strain Ss046)
Q8FGP5 0.0 555 76 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P07330 0.0 554 75 1 350 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain K12)
Q8XCF9 0.0 554 75 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O157:H7
Q83R52 0.0 553 75 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella flexneri
Q1CI99 0.0 550 75 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFM0 0.0 550 75 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis
Q1C6W3 0.0 550 75 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Antiqua)
Q669T5 0.0 549 75 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
P04042 0.0 544 76 1 350 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMY3 0.0 544 76 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57N81 0.0 544 76 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella choleraesuis (strain SC-B67)
Q8Z5V2 0.0 542 76 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhi
Q9FAD8 0.0 533 74 2 351 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Enterobacter cloacae
Q2STS8 4.07e-171 483 66 1 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63PS2 4.53e-171 483 66 1 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
Q3JY65 7.11e-171 483 66 1 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 7.11e-171 483 66 1 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q1QVY7 1.7e-170 481 70 2 342 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q39KQ1 9.91e-170 479 65 1 352 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BRL2 1.36e-169 479 66 1 352 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q2L1D1 1.46e-168 476 68 2 343 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Bordetella avium (strain 197N)
Q46PH7 2.34e-167 473 64 1 344 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q322K2 4.31e-167 471 66 2 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella boydii serotype 4 (strain Sb227)
Q13SY2 9.53e-165 467 66 1 354 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
Q7WAA4 1.88e-164 466 68 1 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WJE7 2.24e-164 465 68 1 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZ94 1.05e-162 461 67 1 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q3SIG0 2.67e-161 458 66 2 342 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
Q1LH11 4.88e-161 457 65 1 345 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1GZZ0 2.1e-158 451 62 3 353 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q820K0 1.48e-152 436 60 3 358 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q39WQ9 1.44e-148 426 60 3 345 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8XQ83 1.47e-148 426 59 3 371 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q221I1 2.29e-138 400 55 2 358 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q9I6V9 4.95e-138 399 59 1 325 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2LSL3 2.26e-128 374 54 3 342 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophus aciditrophicus (strain SB)
Q3BUA2 1.99e-125 367 52 2 345 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLB4 1.99e-125 367 52 2 345 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q4UU97 8.68e-125 365 53 2 337 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8P9J7 8.68e-125 365 53 2 337 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q7NSI8 2.76e-123 362 54 2 340 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q47I43 2.12e-120 354 54 1 346 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
Q3A5A8 1.12e-119 352 52 2 343 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q39SY1 1.06e-118 350 49 1 351 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q5GYV8 2.07e-118 349 52 2 345 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 2.07e-118 349 52 2 345 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P62639 2.09e-118 349 49 2 359 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8F3H4 1.44e-116 344 48 1 339 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62643 1.44e-116 344 48 1 339 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q30RX5 9.92e-115 340 48 2 338 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q8D4X6 1.21e-114 339 50 2 336 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q1MC14 1.4e-114 340 49 3 358 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7NZB3 1.97e-114 339 48 3 354 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P62645 2.33e-114 339 50 1 348 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2RUI8 2.99e-114 338 49 2 356 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q7MBQ5 4.85e-114 337 50 2 336 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q47GX7 7.54e-114 337 48 2 351 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Dechloromonas aromatica (strain RCB)
O87717 2.16e-113 336 54 7 344 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q31HL9 4.41e-113 336 46 5 373 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q89SQ1 1.31e-112 335 50 1 349 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q4ZYD3 2.13e-112 334 48 2 352 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
Q888V8 3.34e-112 333 48 3 355 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2SPQ1 5.69e-112 333 51 3 344 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
Q8EF61 2.05e-111 331 47 3 346 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P62636 3.07e-111 331 48 2 345 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q21ZZ9 3.85e-111 330 46 1 344 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q48ND9 4.7e-111 330 48 3 352 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0HIF6 5.01e-111 330 46 1 345 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
Q6LU34 6.16e-111 330 46 2 348 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Photobacterium profundum (strain SS9)
Q7NV40 8.47e-111 330 48 2 349 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0HVI0 1.06e-110 329 46 1 345 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
Q8EEQ0 9.63e-109 324 46 3 351 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2P5Q6 3.4e-108 323 46 2 351 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2T8Y6 4.37e-108 323 48 2 348 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2IQS6 6.47e-108 322 47 2 347 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q5H2V2 1.01e-107 322 46 2 351 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
P62635 3.27e-107 320 47 2 348 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q30ZJ5 3.18e-106 318 45 2 352 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q52883 3.8e-105 315 50 6 339 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q12IZ9 4.38e-105 315 46 3 347 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8P7A6 4.99e-105 315 45 2 353 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWU6 4.99e-105 315 45 2 353 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain 8004)
Q3BR57 1.13e-104 314 45 2 353 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PIM5 1.27e-104 314 45 2 353 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas axonopodis pv. citri (strain 306)
O85128 1.6e-104 313 48 7 347 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2SFY4 2.35e-104 313 49 5 365 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Hahella chejuensis (strain KCTC 2396)
Q1MLG8 3.9e-104 312 50 8 340 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q20XE6 8.42e-103 310 46 2 360 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodopseudomonas palustris (strain BisB18)
Q21G20 2.68e-102 308 46 1 343 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2KCH8 4.29e-101 305 48 4 335 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0AXB7 2.3e-99 300 47 6 347 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q2IQR9 3.1e-99 300 50 3 341 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2INJ8 9.73e-99 298 45 4 344 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)
P62647 6.57e-97 295 42 3 346 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q9KA55 1.25e-94 288 44 4 343 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9UYF3 4.75e-91 280 42 2 342 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
O58192 3.64e-90 277 41 2 342 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q5JF95 1.02e-89 276 42 3 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q1MP86 4.69e-87 269 43 6 349 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
P62637 3.16e-86 267 40 3 361 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O33558 7.2e-83 259 43 3 346 1 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Cereibacter sphaeroides
Q3J653 1.05e-82 258 43 3 346 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q2T8Y5 6.26e-82 256 43 2 333 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0AYL3 6.66e-81 253 39 6 355 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q5FQQ0 2.29e-80 252 43 7 341 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Gluconobacter oxydans (strain 621H)
Q9WYN9 6.36e-80 250 40 3 335 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q1IQS9 1.08e-79 250 41 3 348 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q311M8 3.75e-79 249 38 3 363 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8RAZ3 4.29e-79 249 39 5 357 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q67P67 9.79e-79 248 42 8 351 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
O29221 2.13e-78 246 41 5 341 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q5L0L0 2.23e-78 246 40 5 351 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q65JK6 3.83e-78 246 39 4 348 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q1D359 4.85e-78 246 43 4 327 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q8KLS5 6.2e-78 246 42 2 331 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Cereibacter sphaeroides
Q3J1W3 3.61e-77 244 42 2 331 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q05522 6.08e-77 243 39 6 348 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q8EQW0 7.81e-77 243 39 5 336 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8F6P9 2.94e-76 241 39 9 349 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62641 2.94e-76 241 39 9 349 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
O83639 2.97e-75 240 38 6 391 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q6AJV3 3.22e-75 239 40 8 361 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q12YX1 1.16e-74 237 40 6 342 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
P62640 3.2e-74 236 38 6 365 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P62646 1.06e-73 235 38 7 369 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q1IRH0 1.72e-73 234 39 5 357 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q39T95 2.63e-73 234 37 6 364 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8ECD7 3.38e-73 234 37 4 367 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HWY6 8.27e-73 233 36 3 366 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
Q0HKN5 8.6e-73 233 36 3 364 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
Q10WZ6 1.23e-72 232 36 6 352 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q3ADA6 9e-72 230 39 6 351 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q24T61 1.77e-71 230 33 4 379 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
Q8PX96 1.16e-70 227 38 4 350 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TUQ0 1.01e-69 224 37 3 350 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P0DMI2 1.89e-69 224 38 7 345 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 1.89e-69 224 38 7 345 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q12PJ3 2.88e-69 224 35 4 380 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q167K9 8.3e-69 223 41 8 348 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q97GZ3 1.19e-68 221 36 9 347 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9KQD8 1.31e-68 222 36 5 374 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q88EW5 2.43e-68 221 37 6 364 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2SBX9 1.29e-67 220 35 3 378 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
Q21IQ9 3.65e-67 218 36 6 349 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q87MK5 3.66e-67 218 35 3 364 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q3ADG9 9.95e-67 216 38 8 349 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q5V0B3 3.76e-66 216 36 7 367 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q485K0 4.79e-66 216 35 7 375 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0AWZ8 6.54e-66 214 37 8 356 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q4KG36 7.1e-66 215 36 6 367 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5QZQ3 8.98e-66 215 34 6 381 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q2ILG8 2.09e-65 213 39 7 338 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
O87125 3.76e-65 213 36 4 362 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q46DT6 7.21e-65 212 35 5 361 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q2RZD2 7.7e-65 212 36 4 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
Q7MIQ5 9.08e-65 213 35 7 378 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q8DB67 1.1e-64 212 35 7 372 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
O52262 3.94e-64 211 36 5 368 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
Q8TLG9 4.43e-64 210 36 5 341 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P62638 4.7e-64 210 34 4 350 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q15RF6 1.33e-63 209 34 5 375 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8Q009 2.16e-63 208 35 5 341 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q085K9 3.19e-63 209 35 5 394 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q3IRR4 4.43e-63 207 34 4 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q1D225 6.33e-63 207 36 9 359 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Myxococcus xanthus (strain DK1622)
Q45047 9.02e-63 207 33 8 386 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A1SMR4 9.89e-63 207 34 6 353 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q1CWZ9 2.21e-62 205 36 2 336 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Myxococcus xanthus (strain DK1622)
Q5E3S1 4.53e-62 205 37 7 372 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q2RRX2 4.93e-62 205 39 8 362 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q9AAK0 8.4e-62 204 37 7 330 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8VL08 3.27e-61 204 36 11 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Azospirillum brasilense
Q6LTM2 7.3e-60 200 34 5 390 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
Q2RX18 1.01e-59 200 34 7 366 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2WAJ8 1.75e-59 199 35 8 369 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q39QJ2 3.69e-59 197 33 4 347 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q39S45 2.04e-58 195 36 7 334 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P72253 2.54e-58 196 36 10 351 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
Q3IDZ3 3.57e-58 196 34 7 374 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
O51376 8.45e-58 194 32 6 366 4 BB_0415 Probable protein-glutamate methylesterase BB_0415 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q89T55 2.34e-56 191 36 7 349 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9KS59 1.07e-54 186 37 7 322 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2FMT2 1.46e-54 185 32 9 351 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q2SFK0 2.01e-54 185 37 5 334 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q2LR65 2.55e-54 184 34 8 350 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
Q2YC79 3.55e-54 184 33 6 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q20XK3 1.11e-53 183 34 7 358 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodopseudomonas palustris (strain BisB18)
Q20YL8 1.98e-53 183 35 7 345 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodopseudomonas palustris (strain BisB18)
Q2W2W9 4.82e-53 181 33 8 351 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P62644 1.79e-52 181 32 6 366 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q1QI44 1.83e-52 181 37 7 334 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q132U2 2.62e-51 177 34 7 338 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain BisB5)
Q2IT50 5.79e-51 177 34 7 343 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain HaA2)
Q1CX06 2.53e-49 172 32 3 340 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Myxococcus xanthus (strain DK1622)
Q3SVA1 4.85e-49 173 32 6 385 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1CZL0 5.17e-49 171 33 6 342 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Myxococcus xanthus (strain DK1622)
Q2W5V5 1.06e-48 170 32 6 326 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2INL1 2.37e-48 169 35 6 337 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q0ARY3 4.62e-46 164 43 2 186 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Maricaulis maris (strain MCS10)
Q0ARY3 5.59e-14 75 39 1 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Maricaulis maris (strain MCS10)
B2J4Q8 5.66e-46 163 30 4 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q9HXT8 2.82e-45 160 33 5 313 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q48GG6 7.71e-45 160 45 4 189 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48GG6 3.51e-16 82 39 0 123 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q394I6 2.18e-44 158 34 6 312 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BMF9 2.56e-44 158 34 6 312 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia orbicola (strain AU 1054)
Q1BLQ3 5.66e-44 157 33 3 310 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia orbicola (strain AU 1054)
Q2FQU2 1.45e-43 156 31 7 332 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q3KFZ6 2.29e-43 157 45 4 183 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
Q3KFZ6 2.56e-17 85 37 0 130 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
Q4ZQV7 2.72e-43 157 45 3 180 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q4ZQV7 2.92e-16 82 39 0 123 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q884V3 6.43e-43 155 45 4 180 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q884V3 4.2e-16 82 44 0 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q393F2 6.46e-43 154 32 3 310 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2RKH8 2.08e-42 155 43 2 188 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RKH8 4.92e-25 108 35 5 232 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q88MS5 5.27e-42 152 30 4 336 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q0A9Z5 7.19e-42 153 43 1 172 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0A9Z5 4.2e-19 90 42 0 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2KV65 3.21e-41 150 33 6 316 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Bordetella avium (strain 197N)
P31758 6.74e-41 149 34 7 300 3 frzG Protein-glutamate methylesterase FrzG Myxococcus xanthus
Q4ZWW3 6.8e-40 146 31 6 301 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. syringae (strain B728a)
Q4KHL8 2.07e-39 145 29 3 337 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48F23 2.37e-39 145 31 4 290 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3KHF6 3.42e-39 144 29 5 347 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain Pf0-1)
Q1LG90 8.97e-39 144 33 4 313 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q46V28 1.74e-38 143 34 6 329 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2T7Z3 6.15e-38 141 32 4 310 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q886S8 2.1e-37 140 31 5 299 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q63J47 1e-36 138 32 4 310 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain K96243)
Q3JJY2 1e-36 138 32 4 310 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain 1710b)
Q4V2X4 1e-36 138 32 4 310 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia mallei (strain ATCC 23344)
Q92YM4 1.89e-36 138 29 8 343 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhizobium meliloti (strain 1021)
Q2IQ87 2.66e-31 124 35 4 315 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q98PD1 6.26e-31 122 28 5 333 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8F5D8 9.55e-22 94 35 3 178 3 cheB2 Putative protein-glutamate methylesterase/protein-glutamine glutaminase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62642 9.55e-22 94 35 3 178 3 cheB2 Putative protein-glutamate methylesterase/protein-glutamine glutaminase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P52931 5.33e-15 76 40 3 110 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P52929 4.74e-14 73 40 3 111 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P52938 4.75e-13 72 31 5 154 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
P52928 2.07e-12 70 41 3 112 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P06534 4.86e-12 68 40 3 111 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q56312 6.45e-12 65 34 2 103 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P52932 6.65e-12 67 38 1 109 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
P0A4I4 3.46e-11 66 37 1 109 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 3.46e-11 66 37 1 109 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P52940 5.81e-11 65 39 1 107 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P42012 2.43e-10 63 28 2 133 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
P58253 2.72e-10 63 31 5 161 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P52941 5.56e-10 62 34 1 109 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P45709 5.81e-10 59 35 3 104 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
P0A4H5 9.63e-10 59 33 3 106 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 9.63e-10 59 33 3 106 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P24072 2.8e-09 57 33 2 103 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
P96126 3.13e-09 58 37 4 106 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
P52934 9.29e-09 58 37 3 107 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
P54662 1.32e-08 58 32 1 106 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
B0R4K1 1.9e-08 55 32 4 105 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8CQK0 1.98e-08 57 33 6 145 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.98e-08 57 33 6 145 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 2.18e-08 57 33 6 147 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P37478 2.92e-08 57 33 3 104 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
P0AFT5 3.01e-08 57 31 4 151 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 3.01e-08 57 31 4 151 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 3.01e-08 57 31 4 151 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 3.01e-08 57 31 4 151 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
P52936 3.21e-08 57 34 3 110 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P59640 3.92e-08 57 31 4 151 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri
Q7A216 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 4.23e-08 56 33 5 137 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 4.23e-08 56 33 5 137 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 4.23e-08 56 33 5 137 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 4.23e-08 56 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8ZNN2 5.23e-08 56 36 2 105 3 btsR Transcriptional regulatory protein BtsR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5C1 6.67e-08 56 36 2 105 3 btsR Transcriptional regulatory protein BtsR Salmonella typhi
Q8ZBV2 7.25e-08 56 31 3 106 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
Q4A160 8.46e-08 55 33 5 137 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P39486 1.14e-07 55 29 2 110 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P28835 1.19e-07 55 32 3 108 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q02998 1.64e-07 56 37 0 78 4 None Uncharacterized 104.1 kDa protein in hypE 3'region Rhodobacter capsulatus
P55184 1.88e-07 54 32 4 133 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
P48259 2.04e-07 54 35 3 108 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P13800 2.56e-07 54 28 1 107 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
Q4UU85 6.34e-07 54 32 5 110 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q8D4U6 7.8e-07 53 27 6 172 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
Q8DET1 9.18e-07 52 24 5 165 3 VV1_0503 Uncharacterized response regulatory protein VV1_0503 Vibrio vulnificus (strain CMCP6)
Q07783 9.7e-07 52 39 3 76 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
P50350 1.11e-06 52 43 2 60 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q9KL96 1.11e-06 52 30 4 110 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P21649 1.15e-06 52 27 2 106 1 mrkE Protein MrkE Klebsiella pneumoniae
A1W0A5 1.27e-06 50 32 5 109 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.27e-06 50 32 5 109 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.27e-06 50 32 5 109 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A8Z181 1.46e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 1.46e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 1.46e-06 52 29 3 103 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 1.46e-06 52 29 3 103 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 1.46e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q6GJ11 1.49e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q4L481 1.54e-06 52 28 3 103 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q2YSS2 1.62e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q932F1 1.65e-06 52 29 3 103 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A1L2 1.79e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 1.79e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 1.79e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 1.79e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 1.79e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 1.79e-06 52 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P28257 1.82e-06 52 34 3 106 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q9ZM64 2.28e-06 49 27 2 106 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q8CQ37 2.28e-06 51 29 3 103 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 2.28e-06 51 29 3 103 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P71403 2.44e-06 49 27 2 106 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
P96602 2.91e-06 51 30 2 104 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P72781 3.53e-06 51 28 3 108 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q87S86 4.14e-06 50 30 3 106 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O78428 4.67e-06 50 33 2 106 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P35163 4.9e-06 50 30 5 110 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P9WGN1 5.37e-06 50 33 3 115 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 5.37e-06 50 33 3 115 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P50351 7.08e-06 50 41 2 60 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8EDD7 7.53e-06 50 29 1 105 3 SO_2823 Uncharacterized response regulatory protein SO_2823 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8GZM2 8.96e-06 50 33 5 109 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 8.96e-06 50 33 5 109 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P94514 9.09e-06 50 20 4 192 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
Q9KU36 9.65e-06 49 29 3 106 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P51358 1.02e-05 49 29 3 115 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
P9WGM3 1.08e-05 49 30 2 103 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 1.08e-05 49 30 2 103 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0A0H3GGB5 1.38e-05 49 33 8 158 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
Q1XDC9 1.46e-05 49 29 3 115 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P0AEV3 1.87e-05 49 31 2 103 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.87e-05 49 31 2 103 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.87e-05 49 31 2 103 3 rssB Regulator of RpoS Escherichia coli O157:H7
P0AE41 3.5e-05 48 25 5 145 3 ypdB Transcriptional regulatory protein YpdB Shigella flexneri
P0AE39 3.5e-05 48 25 5 145 1 ypdB Transcriptional regulatory protein YpdB Escherichia coli (strain K12)
P0AE40 3.5e-05 48 25 5 145 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O157:H7
P40138 3.96e-05 48 33 3 105 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P31908 4.31e-05 48 25 3 138 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8FFE0 4.72e-05 47 26 4 130 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P96686 4.8e-05 47 25 2 107 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P23620 5.68e-05 47 34 5 110 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D0P1 6.78e-05 45 31 4 107 3 cheY Chemotaxis protein CheY Yersinia pestis
P21866 7.39e-05 47 24 10 223 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q7A0U4 7.4e-05 47 31 4 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 7.4e-05 47 31 4 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 7.4e-05 47 31 4 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 7.4e-05 47 31 4 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 7.4e-05 47 31 4 104 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 7.4e-05 47 31 4 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 7.4e-05 47 31 4 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 7.4e-05 47 31 4 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
A2XFB7 7.96e-05 48 36 4 100 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q10N34 8.32e-05 48 36 4 100 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
Q93P00 0.000104 45 33 4 106 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q9ZEP4 0.000151 46 29 3 107 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O69730 0.000165 46 33 4 107 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0R3I8 0.000173 45 28 5 134 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q49VK3 0.000178 45 26 2 103 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1B3X8 0.000193 45 29 5 127 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 0.000193 45 29 5 127 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 0.000193 45 29 5 127 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q82Z76 0.000214 45 28 1 103 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
P42421 0.00022 45 26 3 108 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q9CD68 0.00022 45 28 5 125 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P13792 0.000231 45 32 4 110 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q8EQQ3 0.000232 45 25 1 106 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0D3B6 0.000232 46 35 5 116 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
A2YQ93 0.000234 46 35 5 116 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
A1KHB7 0.000236 45 29 5 127 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 0.000236 45 29 5 127 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q54SP4 0.000247 47 29 2 108 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q82EB1 0.000276 45 31 3 103 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q23917 0.000279 46 28 6 141 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
P0CL17 0.00029 45 33 2 78 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 0.00029 45 33 2 78 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q4A010 0.000305 45 26 2 102 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P13359 0.000315 45 28 6 157 3 virG Regulatory protein VirG Rhizobium rhizogenes
P9WGM9 0.00032 45 29 5 127 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 0.00032 45 29 5 127 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 0.00032 45 29 5 127 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q51373 0.000321 45 29 6 152 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AE90 0.000331 45 32 8 158 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 0.000331 45 32 8 158 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 0.000331 45 32 8 158 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q8DPL7 0.000348 45 30 5 107 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 0.000348 45 30 5 107 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 0.000348 45 30 5 107 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q742C1 0.000401 44 29 5 125 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 0.000401 44 29 5 125 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P52688 0.000422 44 27 2 109 1 citB Transcriptional regulatory protein CitB Klebsiella pneumoniae
P33112 0.000429 44 29 6 117 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P45607 0.000451 44 33 4 107 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
A0PWB4 0.000465 44 25 6 151 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
P0AFJ5 0.000485 44 31 5 113 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 0.000485 44 31 5 113 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 0.000513 44 31 5 113 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q87K77 0.000528 44 26 2 106 3 VPA0021 Uncharacterized response regulatory protein VPA0021 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P51586 0.000537 43 29 2 109 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P52108 0.000543 44 29 3 103 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
P31802 0.000636 44 28 2 128 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P26275 0.000658 44 26 3 130 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q95PI2 0.000666 45 25 5 112 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
P45189 0.000771 43 28 4 104 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8CQ17 0.000789 43 32 4 107 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 0.000789 43 32 4 107 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O07528 0.001 43 27 1 98 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08120
Feature type CDS
Gene -
Product chemotaxis response regulator protein-glutamate methylesterase
Location 1773659 - 1774711 (strand: -1)
Length 1053 (nucleotides) / 350 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_481
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF01339 CheB methylesterase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2201 Signal transduction mechanisms (T) T Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03412 two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44] Two-component system
Bacterial chemotaxis		 -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043038 chemotaxis response regulator protein-glutamate methylesterase VF0967 Motility

Protein Sequence

MNKITVLCVDDSALMRQIMREIINSHHDMEVVDCAPDPIVARDLIKKFNPQVLTLDVEMPRMDGIDFLEKLMRLRPMPVVMVSSLTAKGSEVTLKALELGAVDFVTKPQLGLREGMLAYSELIAEKIRAAAQARISRHETKTLPSKSLSFTPMISSEKLIAVGASTGGTEAIRHFLEPLPITSPAVLITQHMPAGFTHSFAERLNRLCQISVKEAEDGERVLPGHAYIAPGDYHMELRRNGANYQIHINKDPAVNRHRPSVDVLFNSVAKYAGRNAIGVILTGMGSDGATGLLAMRRAGSYTFAQDEASCVVFGMPRSAVELGAVDEVKSISSMSKAVLMKISTTQSLRI

Flanking regions ( +/- flanking 50bp)

TTACTTGCAGGGGCATACGGTTTACGGGCTGACACCAGCAAGGAGAGGTTATGAATAAAATAACGGTACTCTGTGTTGATGATTCGGCGTTAATGCGCCAGATCATGCGAGAAATAATTAATAGTCACCATGATATGGAGGTCGTTGATTGTGCGCCAGATCCGATAGTCGCTCGTGACTTAATAAAAAAGTTTAATCCACAGGTATTGACGTTAGATGTTGAAATGCCACGCATGGATGGTATTGATTTTTTGGAAAAATTAATGCGCTTACGCCCTATGCCAGTGGTGATGGTTTCATCACTCACAGCCAAAGGTTCAGAAGTGACATTAAAAGCATTAGAACTGGGGGCGGTTGATTTTGTCACTAAACCTCAGTTAGGTCTACGTGAAGGAATGTTGGCCTACAGTGAACTTATTGCAGAAAAAATTCGAGCAGCGGCTCAGGCAAGAATTAGTCGTCATGAAACGAAAACATTACCGTCTAAGTCGTTATCATTTACTCCCATGATTTCGAGTGAAAAGTTAATCGCTGTTGGTGCTTCAACAGGGGGCACCGAGGCTATTCGTCATTTTTTAGAGCCATTACCTATTACCAGTCCTGCAGTATTAATAACCCAACATATGCCGGCGGGGTTTACCCACTCATTTGCAGAGCGGTTAAACCGTTTATGCCAAATCAGTGTGAAAGAAGCTGAAGATGGAGAAAGGGTTTTACCTGGACACGCCTACATCGCACCGGGTGATTATCATATGGAGCTTCGTCGTAATGGTGCTAATTACCAGATCCATATAAATAAAGATCCTGCGGTAAATCGGCATCGACCTTCTGTTGATGTGCTATTTAATTCGGTTGCTAAATATGCGGGGCGTAATGCTATTGGTGTCATTTTAACAGGGATGGGCAGTGATGGTGCTACAGGTTTATTAGCAATGCGTCGTGCAGGTAGCTACACATTTGCACAAGATGAAGCAAGCTGCGTCGTCTTTGGGATGCCTCGTTCCGCGGTCGAATTGGGAGCCGTAGATGAGGTAAAAAGTATAAGCTCAATGAGTAAAGCCGTGCTGATGAAAATCAGCACAACACAATCATTGCGTATCTGATTAAGTTCAGTTTAAACAGCAACACAGTAATTTGCCAATATATTTTGAAG