Homologs in group_557

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00770 FBDBKF_00770 100.0 Morganella morganii S1 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
NLDBIP_02685 NLDBIP_02685 100.0 Morganella morganii S4 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
LHKJJB_04200 LHKJJB_04200 100.0 Morganella morganii S3 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
HKOGLL_02845 HKOGLL_02845 100.0 Morganella morganii S5 cheB Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
F4V73_RS06770 F4V73_RS06770 92.4 Morganella psychrotolerans - chemotaxis response regulator protein-glutamate methylesterase
PMI_RS08120 PMI_RS08120 65.7 Proteus mirabilis HI4320 - chemotaxis response regulator protein-glutamate methylesterase

Distribution of the homologs in the orthogroup group_557

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_557

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N5T1 3.58e-159 452 63 2 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D6I7 1.61e-157 448 63 3 357 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Z5V2 5.12e-152 434 62 3 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhi
Q57N81 5.91e-152 434 62 3 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella choleraesuis (strain SC-B67)
Q3Z2R1 2.39e-151 432 60 1 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella sonnei (strain Ss046)
Q8FGP5 2.39e-151 432 60 1 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1RAQ1 2.98e-151 432 60 1 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain UTI89 / UPEC)
Q0TGV0 2.98e-151 432 60 1 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P04042 3.01e-151 432 62 3 356 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMY3 3.01e-151 432 62 3 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q39KQ1 3.95e-151 432 61 3 355 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8XCF9 4.09e-151 432 60 1 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O157:H7
Q83R52 4.77e-151 432 60 1 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella flexneri
P07330 5.74e-151 432 60 1 355 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain K12)
Q1CI99 1.66e-150 431 60 3 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFM0 1.66e-150 431 60 3 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis
Q1C6W3 1.66e-150 431 60 3 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Antiqua)
Q1BRL2 1.74e-150 431 60 2 357 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q669T5 3.09e-150 430 60 3 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q63PS2 8.43e-149 427 59 2 358 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
Q3JY65 9.24e-149 427 59 2 358 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 9.24e-149 427 59 2 358 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q2STS8 1.53e-148 426 59 2 358 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9FAD8 7.24e-148 424 61 1 342 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Enterobacter cloacae
Q46PH7 7.85e-147 421 60 2 349 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q13SY2 1.76e-146 421 60 2 359 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
Q2L1D1 1.43e-144 416 60 3 350 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Bordetella avium (strain 197N)
Q3SIG0 1.86e-142 410 58 1 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
Q1LH11 1.88e-142 410 60 3 355 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7WAA4 8.77e-142 408 59 2 352 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VZ94 8.97e-142 408 59 3 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WJE7 1.93e-141 407 59 2 352 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q820K0 7.41e-141 406 57 2 354 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1GZZ0 3.06e-138 399 55 2 352 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1QVY7 2.18e-137 397 59 2 352 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8XQ83 7.21e-136 394 55 2 370 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q39WQ9 9.46e-133 386 55 1 348 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q322K2 7.63e-125 364 53 2 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella boydii serotype 4 (strain Sb227)
Q7NSI8 4.53e-122 358 53 3 347 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9I6V9 9.93e-121 355 54 3 339 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q221I1 6.03e-120 353 49 2 357 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8D4X6 1.04e-119 352 52 3 342 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q7MBQ5 3.31e-119 351 52 3 342 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q47I43 1.51e-118 349 52 3 353 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
Q0HIF6 5.28e-117 345 49 3 355 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
Q0HVI0 2.56e-116 343 49 3 355 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
Q31HL9 2.66e-115 342 47 4 375 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P62639 1.97e-113 337 49 2 350 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q39SY1 1.51e-112 334 49 2 351 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q2SPQ1 2.6e-111 331 51 2 348 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
Q4UU97 5.21e-111 330 48 4 360 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8P9J7 5.21e-111 330 48 4 360 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q3BUA2 3.46e-110 328 48 4 360 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLB4 3.46e-110 328 48 4 360 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)
P62645 4.5e-110 328 48 1 343 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2LSL3 1.22e-109 327 47 4 350 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophus aciditrophicus (strain SB)
Q89SQ1 1.34e-108 325 48 1 343 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q30RX5 2.63e-108 323 46 3 343 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q52883 3.89e-108 323 51 4 350 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q21G20 4.25e-108 323 48 1 347 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8EF61 2.73e-107 321 46 1 351 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2T8Y6 6.74e-107 320 48 1 345 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2RUI8 7.42e-107 320 47 2 356 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3A5A8 3.6e-106 318 48 3 353 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5GYV8 2.03e-105 316 48 4 360 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 2.03e-105 316 48 4 360 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
O87717 2.61e-105 315 48 3 349 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P62636 4.79e-105 315 46 2 349 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q1MC14 4.94e-104 313 47 3 359 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7NZB3 7.75e-104 312 45 3 353 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NV40 1.18e-103 311 46 2 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q30ZJ5 1.22e-103 311 45 3 351 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q2IQS6 1.77e-102 309 47 3 350 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q4ZYD3 4.51e-102 308 46 3 361 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
O85128 6.76e-102 307 49 7 344 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q48ND9 2.86e-101 306 47 3 357 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q888V8 3.3e-101 305 46 2 355 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1MLG8 3.57e-101 305 48 4 348 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2KCH8 1.57e-100 303 48 3 348 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8F3H4 1.99e-99 300 44 0 343 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62643 1.99e-99 300 44 0 343 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q47GX7 2.11e-99 301 44 3 358 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Dechloromonas aromatica (strain RCB)
Q20XE6 3.39e-97 295 47 3 344 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodopseudomonas palustris (strain BisB18)
Q8EEQ0 3.6e-97 295 44 3 361 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3BR57 2.87e-95 290 45 3 356 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2SFY4 3.59e-95 290 46 2 360 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Hahella chejuensis (strain KCTC 2396)
Q12IZ9 3.65e-95 290 44 3 347 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8PIM5 4.49e-95 290 45 3 356 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas axonopodis pv. citri (strain 306)
Q6LU34 4.34e-94 287 41 1 346 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Photobacterium profundum (strain SS9)
P62635 5.26e-94 287 44 1 349 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
P62647 5.73e-94 287 40 4 352 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q2P5Q6 7.71e-94 286 45 3 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P7A6 1.07e-93 286 45 3 356 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWU6 1.07e-93 286 45 3 356 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain 8004)
Q21ZZ9 3.74e-93 285 43 3 348 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q5H2V2 4.72e-93 284 45 3 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q0AXB7 7.2e-93 283 45 4 338 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9KA55 1.07e-90 278 44 4 347 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5JF95 5.19e-90 277 41 4 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q5L0L0 1.58e-89 275 43 3 349 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q2IQR9 1.67e-89 275 46 5 351 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Anaeromyxobacter dehalogenans (strain 2CP-C)
O58192 3.98e-89 275 41 4 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UYF3 4.2e-89 275 41 4 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q2T8Y5 7.68e-88 271 45 2 341 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2INJ8 7.81e-86 266 44 4 346 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q67P67 9.79e-86 266 42 4 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P62637 4.23e-84 262 39 3 364 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8EQW0 1.47e-81 255 38 5 351 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q1MP86 1.93e-80 252 39 3 353 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
Q1IQS9 2.28e-80 252 42 3 340 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q9WYN9 4.01e-80 251 41 6 341 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O33558 2.44e-79 250 42 4 354 1 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Cereibacter sphaeroides
Q3J653 4.87e-79 249 42 4 354 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
O83639 7.02e-77 244 37 7 388 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q05522 8.11e-76 240 39 6 353 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
P62646 2e-75 240 38 6 364 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5FQQ0 5.94e-75 238 40 6 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Gluconobacter oxydans (strain 621H)
Q65JK6 5.96e-75 238 39 6 350 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q39T95 6.44e-75 238 41 6 350 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8RAZ3 7.9e-75 238 38 7 361 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q167K9 1.25e-74 238 43 5 331 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q3ADA6 1.64e-74 237 39 6 353 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q1D359 2.89e-74 236 40 4 342 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q6AJV3 6.59e-74 236 38 7 366 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8F6P9 9.32e-74 235 38 4 343 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62641 9.32e-74 235 38 4 343 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q0AYL3 1.34e-73 234 37 4 359 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
O29221 2.06e-73 234 37 4 345 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9KQD8 3.8e-73 234 37 3 369 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q88EW5 8.38e-73 233 38 6 370 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q485K0 1.42e-72 233 38 6 354 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q311M8 3.27e-72 231 37 4 364 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A1SMR4 4.23e-72 231 38 5 357 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q7MIQ5 1.37e-71 230 37 3 368 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q21IQ9 2.25e-71 229 36 5 351 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q24T61 2.9e-71 230 35 8 378 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
Q8DB67 2.95e-71 229 37 3 368 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
P62640 3.28e-71 229 36 5 372 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q3J1W3 4.44e-71 228 39 2 341 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
O87125 5.8e-71 228 39 6 364 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1IRH0 1.35e-70 227 39 5 353 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q3KFZ6 1.56e-70 228 37 6 380 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
Q10WZ6 2.08e-70 226 37 7 359 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q8KLS5 6.1e-70 226 41 4 342 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Cereibacter sphaeroides
Q87MK5 6.57e-70 226 37 3 365 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O52262 7.16e-70 226 38 4 367 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
P62638 3.65e-69 223 35 5 363 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8ECD7 6.41e-69 223 36 8 376 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8PX96 2.37e-68 221 37 4 350 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q12YX1 2.06e-67 219 37 7 343 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q0HKN5 2.26e-67 219 36 9 369 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
Q5QZQ3 4.89e-67 219 36 6 356 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q2SBX9 5.05e-67 219 34 4 392 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
Q0HWY6 5.71e-67 218 36 9 376 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
Q5E3S1 7.39e-67 218 37 4 373 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q97GZ3 1.34e-66 216 34 7 355 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8TLG9 1.6e-66 216 37 7 352 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q2RZD2 7.29e-66 215 37 6 351 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
Q3ADG9 1.57e-65 213 38 9 353 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q12PJ3 1.83e-65 215 35 7 360 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0AWZ8 2.99e-65 213 37 8 358 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q46DT6 6.43e-65 213 36 7 359 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q6LTM2 1.09e-64 213 35 6 388 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
Q2FMT2 1.25e-64 211 33 8 360 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8Q009 3.94e-64 210 35 8 357 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q15RF6 4.24e-64 211 36 4 354 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5V0B3 6.93e-64 210 36 6 359 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q0A9Z5 7.59e-64 211 33 4 382 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2RX18 1.35e-63 210 37 9 366 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q39S45 2.93e-63 208 38 7 332 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8TUQ0 4.01e-63 207 36 5 355 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q2RRX2 4.21e-63 208 40 7 350 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2WAJ8 4.24e-63 208 35 7 377 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2YC79 6.25e-63 207 35 6 351 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q085K9 1.03e-62 208 37 8 374 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q2LR65 1.43e-62 206 37 7 353 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
O51376 1.07e-61 204 31 8 373 4 BB_0415 Probable protein-glutamate methylesterase BB_0415 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q3IDZ3 1.74e-61 204 36 6 364 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
Q39QJ2 2.15e-61 203 33 3 348 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q3IRR4 2.49e-61 203 35 4 348 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P0DMI2 2.79e-61 202 36 4 334 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 2.79e-61 202 36 4 334 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q2ILG8 3.37e-60 200 37 7 346 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2RKH8 7.35e-59 199 34 8 416 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9AAK0 8.04e-59 196 36 6 354 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1QI44 1.06e-58 197 35 5 359 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P72253 5.18e-58 196 33 6 368 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
Q3SVA1 5.97e-58 196 34 11 404 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1D225 1.81e-57 193 37 8 338 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Myxococcus xanthus (strain DK1622)
Q8VL08 3.3e-57 193 34 9 364 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Azospirillum brasilense
Q45047 2.71e-56 191 31 6 399 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P62644 1.8e-55 189 34 9 375 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q132U2 5.85e-55 187 34 5 361 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain BisB5)
Q9KS59 1.33e-54 186 35 5 332 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1CWZ9 3.24e-54 184 36 2 327 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Myxococcus xanthus (strain DK1622)
Q20YL8 1.12e-53 184 34 8 350 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodopseudomonas palustris (strain BisB18)
Q20XK3 2.33e-53 182 36 7 337 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodopseudomonas palustris (strain BisB18)
Q2INL1 5.17e-51 176 35 7 337 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2IT50 1.58e-50 176 32 7 372 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain HaA2)
B2J4Q8 2.85e-50 174 32 5 353 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q2SFK0 6.48e-50 173 35 10 354 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q89T55 8.83e-50 174 33 9 358 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2W2W9 3.88e-49 171 33 7 355 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q1CX06 2.2e-47 167 35 5 343 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Myxococcus xanthus (strain DK1622)
Q2FQU2 2.55e-47 166 32 8 338 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q1CZL0 5.71e-46 163 32 5 336 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Myxococcus xanthus (strain DK1622)
Q0ARY3 5.03e-45 162 46 1 184 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Maricaulis maris (strain MCS10)
Q0ARY3 1.47e-16 83 42 1 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Maricaulis maris (strain MCS10)
Q4ZQV7 1.57e-44 160 46 3 179 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q4ZQV7 6.85e-20 93 42 0 123 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q1BLQ3 1.58e-44 159 32 6 353 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia orbicola (strain AU 1054)
P31758 4.49e-44 157 34 8 308 3 frzG Protein-glutamate methylesterase FrzG Myxococcus xanthus
Q2W5V5 1.2e-43 157 32 11 335 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q3KHF6 2.36e-43 155 32 5 346 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain Pf0-1)
Q393F2 6.13e-43 155 32 6 349 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4KHL8 8.53e-43 154 31 6 346 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q46V28 1.04e-42 154 34 7 346 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q88MS5 2.2e-42 153 32 7 351 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q394I6 7.39e-41 149 32 6 359 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BMF9 8.3e-41 149 32 6 359 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia orbicola (strain AU 1054)
Q9HXT8 1.92e-40 148 31 5 351 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q48F23 6.57e-40 147 30 8 355 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q886S8 6.85e-40 146 30 6 347 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZWW3 1.09e-38 143 29 7 357 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. syringae (strain B728a)
Q2T7Z3 1.2e-37 140 32 5 342 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q92YM4 1.22e-37 141 29 7 353 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhizobium meliloti (strain 1021)
Q2KV65 3.41e-37 139 30 5 342 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Bordetella avium (strain 197N)
Q1LG90 7.06e-37 139 31 6 348 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q63J47 3.62e-36 137 31 5 342 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain K96243)
Q3JJY2 3.62e-36 137 31 5 342 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain 1710b)
Q4V2X4 3.62e-36 137 31 5 342 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia mallei (strain ATCC 23344)
Q98PD1 6.72e-33 128 30 7 349 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2IQ87 4.73e-28 115 31 5 323 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8F5D8 1.11e-25 105 37 3 177 3 cheB2 Putative protein-glutamate methylesterase/protein-glutamine glutaminase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62642 1.11e-25 105 37 3 177 3 cheB2 Putative protein-glutamate methylesterase/protein-glutamine glutaminase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q4KG36 6.87e-20 93 39 1 137 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48GG6 7.05e-20 93 42 0 123 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q884V3 7.97e-20 93 42 0 123 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P52931 1.83e-16 80 44 3 110 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P52929 8.15e-15 75 41 3 111 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P52941 3.79e-14 74 38 1 109 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q56312 8.18e-13 67 34 2 104 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P06534 1.79e-12 70 41 3 111 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P52932 2.18e-12 68 39 1 109 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
P52928 3e-12 69 37 1 109 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P52940 5.44e-12 68 38 1 107 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P0A4I4 1.13e-11 67 36 1 109 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 1.13e-11 67 36 1 109 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P45709 1.81e-11 63 38 2 104 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
P58253 2.36e-11 67 36 1 108 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P52938 2.58e-11 67 34 3 111 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
P0A4H5 3.66e-11 63 35 3 106 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 3.66e-11 63 35 3 106 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P24072 4.74e-11 62 33 2 104 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
P55184 7.13e-11 64 35 2 106 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
P52934 9.04e-11 65 38 3 108 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
P42012 9.53e-11 65 31 1 109 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q9KL96 1.59e-10 64 35 2 100 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P52936 3.4e-10 63 35 3 109 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P39486 1.04e-09 61 29 1 107 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P28835 1.16e-09 61 33 3 110 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P96602 1.2e-09 61 34 2 108 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
O78428 1.71e-09 61 36 2 106 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P96686 3.17e-09 59 28 1 103 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
B0R4K1 4.44e-09 57 34 3 105 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P13800 4.61e-09 59 28 1 107 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
P96126 1.26e-08 56 37 4 107 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q8CQK0 1.85e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.85e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A216 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 2.23e-08 57 37 3 105 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 2.23e-08 57 37 3 105 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 2.23e-08 57 37 3 105 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 2.23e-08 57 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P54662 2.56e-08 57 29 1 106 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
Q8D4U6 2.66e-08 57 33 2 109 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
Q4A160 4.42e-08 56 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P21649 4.54e-08 57 27 1 107 1 mrkE Protein MrkE Klebsiella pneumoniae
Q4LAJ9 5.91e-08 56 37 3 105 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q4UU85 9.67e-08 57 31 5 110 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q02998 1.17e-07 57 35 0 78 4 None Uncharacterized 104.1 kDa protein in hypE 3'region Rhodobacter capsulatus
P28257 1.19e-07 55 33 3 109 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q82Z76 1.2e-07 55 31 1 103 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
P48259 1.8e-07 55 32 3 110 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q4L481 3.42e-07 53 29 3 103 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q8Z5C1 3.46e-07 54 31 1 105 3 btsR Transcriptional regulatory protein BtsR Salmonella typhi
P9WGM3 3.47e-07 53 30 2 104 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 3.47e-07 53 30 2 104 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8ZNN2 3.52e-07 54 31 1 105 3 btsR Transcriptional regulatory protein BtsR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37478 3.82e-07 53 29 7 149 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q87K77 5.94e-07 53 31 2 103 3 VPA0021 Uncharacterized response regulatory protein VPA0021 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0AFT5 6.74e-07 53 30 1 105 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 6.74e-07 53 30 1 105 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 6.74e-07 53 30 1 105 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 6.74e-07 53 30 1 105 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
P51358 7.19e-07 53 33 3 109 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
P72781 7.46e-07 53 30 3 108 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P59640 7.54e-07 53 30 1 105 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri
P9WGN1 8.01e-07 52 37 2 88 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 8.01e-07 52 37 2 88 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P94514 9.15e-07 53 27 2 119 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
P42421 9.58e-07 52 28 2 104 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q07783 1.07e-06 52 43 2 60 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q1XDC9 1.12e-06 52 33 3 109 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P39663 1.56e-06 52 31 5 129 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q93P00 1.61e-06 50 33 4 111 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q8CQ37 2.11e-06 51 30 3 103 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 2.11e-06 51 30 3 103 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P13359 2.42e-06 51 31 4 121 3 virG Regulatory protein VirG Rhizobium rhizogenes
P50350 2.91e-06 51 43 2 60 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q1B3X8 3.03e-06 51 30 4 121 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 3.03e-06 51 30 4 121 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 3.03e-06 51 30 4 121 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q6GJ11 3.68e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q8DPL7 3.79e-06 51 30 2 104 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 3.79e-06 51 30 2 104 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 3.79e-06 51 30 2 104 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8Z181 4.08e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 4.08e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 4.08e-06 50 29 3 103 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 4.08e-06 50 29 3 103 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 4.08e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q9ZM64 4.18e-06 48 26 2 108 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P71403 4.26e-06 48 26 2 108 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q2YSS2 4.52e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A1L2 4.69e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 4.69e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 4.69e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 4.69e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 4.69e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 4.69e-06 50 29 3 103 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P50351 4.74e-06 50 43 2 60 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0DMK7 5.1e-06 50 42 1 63 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 5.1e-06 50 42 1 63 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q932F1 5.34e-06 50 29 3 103 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A1W0A5 5.67e-06 48 27 5 111 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 5.67e-06 48 27 5 111 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 5.67e-06 48 27 5 111 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q8D0P1 5.83e-06 48 31 3 110 3 cheY Chemotaxis protein CheY Yersinia pestis
A1TEL7 6.08e-06 50 30 4 121 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8ZBV2 7.08e-06 50 29 2 105 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
P21866 8.19e-06 50 29 5 118 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P0AE41 8.85e-06 50 26 1 114 3 ypdB Transcriptional regulatory protein YpdB Shigella flexneri
P0AE39 8.85e-06 50 26 1 114 1 ypdB Transcriptional regulatory protein YpdB Escherichia coli (strain K12)
P0AE40 8.85e-06 50 26 1 114 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O157:H7
P9WGM5 9.56e-06 49 31 1 106 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 9.56e-06 49 31 1 106 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8FFE0 1e-05 50 25 1 105 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B8GZM2 1.07e-05 50 34 5 110 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 1.07e-05 50 34 5 110 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P06628 1.11e-05 47 31 3 105 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P0AEV3 1.28e-05 50 33 4 105 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.28e-05 50 33 4 105 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.28e-05 50 33 4 105 3 rssB Regulator of RpoS Escherichia coli O157:H7
P35163 1.41e-05 49 31 5 107 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P52942 1.75e-05 47 29 3 105 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
O07528 1.85e-05 48 31 1 98 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q8NYJ9 2.07e-05 48 28 4 108 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 2.07e-05 48 28 4 108 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 2.07e-05 48 28 4 108 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 2.07e-05 48 28 4 108 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 2.07e-05 48 28 4 108 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q2YV56 2.18e-05 48 28 4 108 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GK93 2.24e-05 48 28 4 108 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
P31802 2.45e-05 48 31 1 104 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
A6X580 2.5e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8DET1 2.65e-05 48 28 2 105 3 VV1_0503 Uncharacterized response regulatory protein VV1_0503 Vibrio vulnificus (strain CMCP6)
A0R3I8 2.7e-05 48 30 3 106 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8FW53 3.01e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 3.01e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 3.01e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 3.01e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 3.01e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 3.01e-05 46 27 4 119 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 3.01e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 3.01e-05 46 27 4 119 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q7WZY4 3.03e-05 48 30 2 105 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
Q82EB1 3.25e-05 48 30 3 110 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1KHB7 3.33e-05 48 28 4 121 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 3.33e-05 48 28 4 121 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMF9 3.93e-05 47 27 3 138 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 3.93e-05 47 27 3 138 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q00934 4.22e-05 48 32 5 110 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44929 4.28e-05 48 32 1 74 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P69228 4.62e-05 47 30 5 114 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 4.62e-05 47 30 5 114 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7A7X9 4.71e-05 47 28 4 108 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 4.71e-05 47 28 4 108 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A0A0H3GGB5 5.13e-05 47 32 8 152 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
Q9TLQ4 5.15e-05 47 29 3 107 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P9WGM9 5.19e-05 47 28 4 121 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 5.19e-05 47 28 4 121 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 5.19e-05 47 28 4 121 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q9KU36 5.74e-05 47 29 1 105 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZEP4 5.82e-05 47 31 3 109 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
T2KMF4 5.83e-05 48 24 7 158 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q9KQD5 6.64e-05 45 28 3 110 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 6.64e-05 45 28 3 110 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q742C1 6.74e-05 47 28 4 121 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 6.74e-05 47 28 4 121 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P08368 6.86e-05 47 33 4 105 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q8Z7H2 7.02e-05 47 29 3 113 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P0DM78 8.37e-05 47 29 3 113 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 8.37e-05 47 29 3 113 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 8.37e-05 47 29 3 113 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 8.37e-05 47 29 3 113 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 8.37e-05 47 29 3 113 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P26275 8.39e-05 47 30 2 106 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0PWB4 9e-05 47 27 4 122 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q4L8V4 9.4e-05 47 27 1 105 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
P94439 9.55e-05 46 28 2 105 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
P45607 0.000109 46 32 4 108 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P52688 0.00011 46 25 1 108 1 citB Transcriptional regulatory protein CitB Klebsiella pneumoniae
Q7CQM5 0.00011 46 26 1 107 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q06065 0.000117 47 33 4 106 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q940D0 0.000118 47 42 1 63 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P0AFJ5 0.000125 46 32 4 108 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 0.000125 46 32 4 108 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 0.000132 46 32 4 108 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q9CD68 0.000137 46 27 4 121 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q4A010 0.000138 46 24 1 105 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q51373 0.000161 45 30 2 121 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87S86 0.000163 46 28 2 102 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q52376 0.000172 45 30 2 117 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
P54884 0.000177 45 42 4 80 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
P95582 0.000183 45 30 2 117 3 gacA Response regulator GacA Pseudomonas viridiflava
P51586 0.000203 44 29 2 109 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P40138 0.000206 46 32 2 104 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
O69730 0.000207 45 33 4 107 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O25153 0.000214 47 27 4 111 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
P9WGL9 0.000241 45 42 4 80 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 0.000241 45 42 4 80 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 0.000241 45 42 4 80 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9F868 0.000249 45 42 4 80 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9K998 0.00026 45 22 1 105 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0AE90 0.000271 45 33 7 136 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 0.000271 45 33 7 136 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 0.000271 45 33 7 136 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q7A0U4 0.000276 45 29 3 105 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 0.000276 45 29 3 105 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 0.000276 45 29 3 105 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 0.000276 45 29 3 105 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 0.000276 45 29 3 105 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 0.000276 45 29 3 105 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 0.000276 45 29 3 105 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 0.000276 45 29 3 105 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q06239 0.000279 45 31 5 108 3 vanR Regulatory protein VanR Enterococcus faecium
Q9ZWJ9 0.000293 46 44 1 58 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
P23620 0.000302 45 33 5 109 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04942 0.000336 45 31 2 69 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q57QC3 0.000413 44 27 3 113 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q9I4F9 0.000456 44 28 4 107 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q83RR0 0.000461 44 29 3 113 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 0.000461 44 29 3 113 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O32197 0.000468 44 28 1 104 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
P94413 0.000471 44 32 1 62 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q7MM78 0.000498 45 32 5 103 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 0.000498 45 32 5 103 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P07545 0.000498 44 32 4 115 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P23836 0.000511 44 29 3 113 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
P33112 0.000547 44 30 5 117 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P52108 0.000555 44 31 3 102 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
P45605 0.00058 44 31 4 108 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P31908 0.000604 45 26 1 103 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9KT84 0.000623 45 33 5 103 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O05251 0.000626 44 27 2 106 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q01473 0.000699 45 24 11 267 3 rcaC Protein RcaC Microchaete diplosiphon
Q8EQQ3 0.000709 44 22 1 106 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9RC52 0.000769 43 25 6 144 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8Z333 0.000784 44 28 3 107 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P13792 0.000791 44 33 4 106 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P25852 0.000827 44 28 3 107 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2KCH7 0.00083 42 30 4 109 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P42244 0.00085 43 38 3 67 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q54SP4 0.000868 45 26 3 133 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q04849 0.001 44 30 6 123 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P28787 0.001 44 28 5 118 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q7XS69 0.001 44 36 5 96 3 RR29 Two-component response regulator ORR29 Oryza sativa subsp. japonica

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00775
Feature type CDS
Gene cheB
Product Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains
Location 168393 - 169460 (strand: 1)
Length 1068 (nucleotides) / 355 (amino acids)
In genomic island -

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_557
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF01339 CheB methylesterase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2201 Signal transduction mechanisms (T) T Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03412 two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44] Two-component system
Bacterial chemotaxis
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043207 chemotaxis-specific methylesterase CheB VF0394 Motility

Protein Sequence

MKKIKVLCVDDSALMRQLMREIINSHPDMTVVDVAPDPYVARDLIKQHEPDVVTLDVEMPRMDGIDFLEKLMRLHPVPVVMVSTLTSKGSEVTLKALELGAVDFVTKPQIGIRETMMSYRDLIGEKIRAAAMSKITQGNRFRRQEKVTAAPAVISKPLSSYACHNRLIAVGASTGGTEAIRQFLEMLPPECPPVVITQHMPAGFTRSFAERLNKLCALTVKEAEHGDVLRKGHAYIAPGDAHMLIADKGQGYQVVLQQTPPVNRHRPSVDVLFDSVAECAARKCIAVLLTGMGMDGARGMLNLRQKGAVTYAQDERSCVVFGMPRAAIELNAVDEIQDLVKIAPSVLGRLAAVSA

Flanking regions ( +/- flanking 50bp)

TGTCATCAGAGGACAGACCGTGTACAGCATTCAGGCGGCCGGGAGAAGTGATGAAAAAAATAAAAGTACTTTGCGTTGATGACTCGGCGCTGATGCGCCAGTTAATGCGTGAAATTATTAACAGCCATCCGGATATGACCGTGGTGGACGTGGCACCGGATCCGTATGTTGCGCGTGATCTGATTAAACAGCATGAACCGGATGTGGTAACGCTGGATGTGGAAATGCCGCGGATGGACGGCATCGATTTTCTGGAAAAACTGATGCGTCTGCACCCGGTACCGGTGGTGATGGTCTCCACACTGACCTCCAAAGGCTCGGAAGTGACCCTGAAAGCCCTGGAACTCGGTGCGGTGGATTTTGTCACCAAACCGCAGATCGGGATCCGCGAAACCATGATGAGTTACCGCGACCTTATCGGTGAAAAAATCCGTGCCGCAGCGATGTCAAAAATCACGCAGGGTAACCGCTTCCGCCGCCAGGAAAAAGTGACGGCAGCACCGGCGGTTATCAGCAAACCGCTGTCATCGTATGCCTGCCATAACCGCCTGATTGCGGTGGGCGCATCGACCGGCGGAACGGAAGCTATCCGTCAGTTCCTGGAGATGCTGCCGCCTGAGTGTCCGCCGGTGGTGATCACCCAGCATATGCCGGCCGGTTTCACCCGCTCATTTGCCGAGCGTCTGAACAAGCTCTGTGCGCTGACGGTAAAAGAGGCGGAACACGGCGATGTGCTGCGCAAAGGGCATGCTTATATTGCCCCGGGCGATGCGCATATGCTGATCGCGGATAAAGGCCAGGGTTACCAGGTGGTGCTTCAGCAGACACCGCCGGTGAACCGTCACCGTCCGTCCGTGGATGTGCTGTTTGACTCAGTGGCCGAATGTGCCGCCCGCAAATGCATCGCGGTCCTGCTGACCGGTATGGGTATGGACGGTGCGCGCGGCATGCTGAATCTGCGGCAGAAAGGCGCGGTCACGTATGCCCAGGATGAGCGCAGCTGCGTGGTCTTCGGTATGCCGCGCGCGGCGATTGAACTGAATGCGGTCGATGAAATTCAGGATCTCGTCAAAATTGCCCCCAGTGTGCTGGGCAGACTTGCTGCCGTTTCCGCCTGACGGAACCGGCAATTATTCATTGTATTATTGCAGGAGTGGTTATGGCCGCT