Homologs in group_475

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00725 FBDBKF_00725 35.7 Morganella morganii S1 flgM flagellar biosynthesis anti-sigma factor FlgM
EHELCC_00820 EHELCC_00820 35.7 Morganella morganii S2 flgM flagellar biosynthesis anti-sigma factor FlgM
NLDBIP_02640 NLDBIP_02640 35.7 Morganella morganii S4 flgM flagellar biosynthesis anti-sigma factor FlgM
LHKJJB_04155 LHKJJB_04155 35.7 Morganella morganii S3 flgM flagellar biosynthesis anti-sigma factor FlgM
HKOGLL_02890 HKOGLL_02890 35.7 Morganella morganii S5 flgM flagellar biosynthesis anti-sigma factor FlgM
F4V73_RS06735 F4V73_RS06735 37.8 Morganella psychrotolerans flgM flagellar biosynthesis anti-sigma factor FlgM

Distribution of the homologs in the orthogroup group_475

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_475

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96974 1.52e-65 195 98 0 99 3 flgM Negative regulator of flagellin synthesis Proteus mirabilis
A1JT31 6.71e-26 95 50 1 97 3 flgM Negative regulator of flagellin synthesis Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P0C2V6 8.53e-26 95 50 1 97 3 flgM Negative regulator of flagellin synthesis Yersinia enterocolitica
P26477 3.49e-18 75 47 2 93 1 flgM Negative regulator of flagellin synthesis Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEM5 2.46e-14 65 42 1 97 3 flgM Negative regulator of flagellin synthesis Shigella flexneri
P0AEM4 2.46e-14 65 42 1 97 1 flgM Negative regulator of flagellin synthesis Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08085
Feature type CDS
Gene flgM
Product flagellar biosynthesis anti-sigma factor FlgM
Location 1766296 - 1766595 (strand: 1)
Length 300 (nucleotides) / 99 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_475
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04316 Anti-sigma-28 factor, FlgM

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2747 Transcription (K)
Cell motility (N)		 KN Negative regulator of flagellin synthesis (anti-sigma28 factor)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02398 negative regulator of flagellin synthesis FlgM Two-component system
Biofilm formation - Pseudomonas aeruginosa
Biofilm formation - Escherichia coli
Flagellar assembly		 -

Protein Sequence

MSIERTNPLIPITAISQRNLNEGAQEARKTGNTQTKAMAGDTSVKLSEAQKKLVQPSNQDINVEKVARLKAAIADGTLTMDSSKIAEALFREAAESITK

Flanking regions ( +/- flanking 50bp)

TACAATGGCTTCATCTGACGATTAATTGATGCCTAACAAAGGATTTTCCTATGAGTATTGAACGCACAAATCCACTTATCCCAATCACGGCCATTTCTCAGCGTAACCTTAATGAAGGTGCCCAAGAAGCACGAAAAACCGGTAATACGCAAACAAAAGCAATGGCGGGTGATACTTCTGTGAAACTAAGTGAAGCACAGAAAAAATTAGTTCAACCTAGCAATCAAGACATCAATGTCGAAAAAGTTGCCCGTTTAAAAGCAGCGATTGCCGATGGAACATTAACAATGGACAGCAGCAAAATTGCGGAAGCACTTTTCCGAGAAGCTGCTGAAAGCATAACTAAATAATATTAAAGATTATGATGGAAGAACTCCGCCAGACCTTAGATCTTCAGTTA