Homologs in group_475

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00725 FBDBKF_00725 100.0 Morganella morganii S1 flgM flagellar biosynthesis anti-sigma factor FlgM
EHELCC_00820 EHELCC_00820 100.0 Morganella morganii S2 flgM flagellar biosynthesis anti-sigma factor FlgM
LHKJJB_04155 LHKJJB_04155 100.0 Morganella morganii S3 flgM flagellar biosynthesis anti-sigma factor FlgM
HKOGLL_02890 HKOGLL_02890 100.0 Morganella morganii S5 flgM flagellar biosynthesis anti-sigma factor FlgM
F4V73_RS06735 F4V73_RS06735 84.9 Morganella psychrotolerans flgM flagellar biosynthesis anti-sigma factor FlgM
PMI_RS08085 PMI_RS08085 35.7 Proteus mirabilis HI4320 flgM flagellar biosynthesis anti-sigma factor FlgM

Distribution of the homologs in the orthogroup group_475

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_475

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P26477 3.79e-13 63 33 1 98 1 flgM Negative regulator of flagellin synthesis Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0C2V6 4.25e-13 62 36 0 91 3 flgM Negative regulator of flagellin synthesis Yersinia enterocolitica
A1JT31 8.87e-13 62 36 0 91 3 flgM Negative regulator of flagellin synthesis Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P96974 1.34e-12 61 36 1 97 3 flgM Negative regulator of flagellin synthesis Proteus mirabilis
P0AEM5 6.83e-12 59 35 2 99 3 flgM Negative regulator of flagellin synthesis Shigella flexneri
P0AEM4 6.83e-12 59 35 2 99 1 flgM Negative regulator of flagellin synthesis Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02640
Feature type CDS
Gene flgM
Product flagellar biosynthesis anti-sigma factor FlgM
Location 492537 - 492857 (strand: 1)
Length 321 (nucleotides) / 106 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_475
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04316 Anti-sigma-28 factor, FlgM

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2747 Transcription (K)
Cell motility (N)		 KN Negative regulator of flagellin synthesis (anti-sigma28 factor)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02398 negative regulator of flagellin synthesis FlgM Two-component system
Biofilm formation - Pseudomonas aeruginosa
Biofilm formation - Escherichia coli
Flagellar assembly		 -

Protein Sequence

MAIEQTSAISALTKVTNRDPKELTAPVRDKKVQAEETVRESAFSPSELQKQLLAPGKNDINTARVAEIKQALKDGTLRMDAGKIADGLLRDAHECMLSMDSADKND

Flanking regions ( +/- flanking 50bp)

CAAGGGAGGCGCCCCTCCATCTCATACAGATCGGGAAAAGGAAAACAGATATGGCAATTGAGCAAACATCCGCGATTTCAGCACTGACAAAAGTGACTAACCGCGACCCGAAAGAGCTGACCGCGCCGGTGCGCGATAAAAAAGTTCAGGCAGAAGAGACTGTCCGCGAAAGCGCATTTTCGCCGAGTGAACTTCAGAAGCAGCTGCTTGCGCCGGGTAAAAACGACATTAATACTGCACGGGTGGCAGAAATTAAACAGGCGCTGAAAGACGGCACATTACGGATGGATGCCGGTAAAATCGCTGACGGTCTGCTGCGCGATGCGCATGAGTGCATGTTATCCATGGACAGCGCCGATAAAAATGACTGATCAACTTCTGCCGCTGCTGGATCAACAACTCTCTCATTTACAGTCACTGC