Homologs in group_537

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00645 FBDBKF_00645 71.9 Morganella morganii S1 fliQ flagellar biosynthesis protein FliQ
EHELCC_00900 EHELCC_00900 71.9 Morganella morganii S2 fliQ flagellar biosynthesis protein FliQ
NLDBIP_02560 NLDBIP_02560 71.9 Morganella morganii S4 fliQ flagellar biosynthesis protein FliQ
LHKJJB_04075 LHKJJB_04075 71.9 Morganella morganii S3 fliQ flagellar biosynthesis protein FliQ
HKOGLL_02970 HKOGLL_02970 71.9 Morganella morganii S5 fliQ flagellar biosynthesis protein FliQ
F4V73_RS06655 F4V73_RS06655 69.7 Morganella psychrotolerans fliQ flagellar biosynthesis protein FliQ

Distribution of the homologs in the orthogroup group_537

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_537

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1L5 2.13e-33 113 74 0 89 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1L6 2.13e-33 113 74 0 89 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhi
P57185 6.5e-33 112 64 0 84 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AZ1 8.97e-30 104 60 0 84 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8KA36 1.31e-28 101 65 0 88 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0AC10 1.49e-27 98 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Shigella flexneri
P0AC07 1.49e-27 98 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Escherichia coli (strain K12)
P0AC08 1.49e-27 98 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC09 1.49e-27 98 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Escherichia coli O157:H7
P34201 1.6e-26 95 68 0 89 3 fliQ Flagellar biosynthetic protein FliQ Pectobacterium carotovorum subsp. carotovorum
P35535 1.01e-21 84 46 0 89 3 fliQ Flagellar biosynthetic protein FliQ Bacillus subtilis (strain 168)
P0A0S3 7.38e-18 73 50 0 85 3 fliQ Flagellar biosynthetic protein FliQ Helicobacter pylori (strain ATCC 700392 / 26695)
P0A0S4 7.38e-18 73 50 0 85 3 fliQ Flagellar biosynthetic protein FliQ Helicobacter pylori (strain J99 / ATCC 700824)
O67774 1.46e-16 70 45 0 85 3 fliQ Flagellar biosynthetic protein FliQ Aquifex aeolicus (strain VF5)
P74931 5.05e-16 69 42 0 88 3 fliQ Flagellar biosynthetic protein FliQ Treponema pallidum (strain Nichols)
P0CF98 2.06e-13 62 37 0 88 3 fliQ Flagellar biosynthetic protein FliQ Clostridium tetani (strain Massachusetts / E88)
Q44906 3.15e-11 57 40 0 82 3 fliQ Flagellar biosynthetic protein FliQ Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q45974 4.38e-08 49 40 0 87 3 fliQ Flagellar biosynthetic protein FliQ Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P69983 1.96e-06 45 33 0 69 3 yscS Yop proteins translocation protein S Yersinia pseudotuberculosis serotype I (strain IP32953)
P69982 1.96e-06 45 33 0 69 3 yscS Yop proteins translocation protein S Yersinia pestis
P74891 2.25e-06 44 33 0 80 3 ssaS Secretion system apparatus protein SsaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55721 2.97e-06 44 31 0 87 3 NGR_a00600 Probable translocation protein y4yM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0A1L7 0.000451 38 32 0 67 1 spaQ Surface presentation of antigens protein SpaQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1M3 0.000451 38 32 0 67 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhisuis
P0A1L8 0.000451 38 32 0 67 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhi
P0A1M2 0.000451 38 32 0 67 3 spaQ Surface presentation of antigens protein SpaQ Salmonella senftenberg
P0A1M1 0.000451 38 32 0 67 3 spaQ Surface presentation of antigens protein SpaQ Salmonella gallinarum
P0A1M0 0.000451 38 32 0 67 3 spaQ Surface presentation of antigens protein SpaQ Salmonella enteritidis
P0A1L9 0.000451 38 32 0 67 3 spaQ Surface presentation of antigens protein SpaQ Salmonella dublin

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08015
Feature type CDS
Gene fliQ
Product flagellar biosynthesis protein FliQ
Location 1753280 - 1753549 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_537
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01313 Bacterial export proteins, family 3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1987 Cell motility (N) N Flagellar biosynthesis protein FliQ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02420 flagellar biosynthesis protein FliQ Flagellar assembly -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG002339 flagellar biosynthetic protein FliQ VF0394 Motility

Protein Sequence

MTPESVLALGTEAMKIALSLAGPLLLSALVTGLVISMLQAATQINEMTLSFIPKILAVLAAILVAGPWMLSLLLDYMHNLFTGIPGMIG

Flanking regions ( +/- flanking 50bp)

ATACTTGGCTCATTGGCTCAAAGCTTTTTTAACTAGCAAAGAGGTTCTTTATGACGCCTGAATCTGTTTTAGCATTAGGAACGGAAGCGATGAAAATTGCCTTATCCCTTGCTGGACCTCTATTATTGTCTGCACTGGTTACCGGTTTAGTAATAAGCATGCTGCAAGCAGCAACACAAATAAACGAAATGACACTGTCGTTTATTCCTAAGATCCTTGCTGTATTAGCGGCTATTTTAGTCGCAGGCCCGTGGATGCTCAGTTTGTTATTAGACTATATGCATAACTTATTTACTGGCATTCCAGGAATGATTGGCTAATAACAATGATAACCTTGACCAGTGAAATACTTAATGGCTACATCAGTGAT