Homologs in group_461

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00645 FBDBKF_00645 93.3 Morganella morganii S1 fliQ flagellar biosynthesis protein FliQ
EHELCC_00900 EHELCC_00900 93.3 Morganella morganii S2 fliQ flagellar biosynthesis protein FliQ
NLDBIP_02560 NLDBIP_02560 93.3 Morganella morganii S4 fliQ flagellar biosynthesis protein FliQ
LHKJJB_04075 LHKJJB_04075 93.3 Morganella morganii S3 fliQ flagellar biosynthesis protein FliQ
HKOGLL_02970 HKOGLL_02970 93.3 Morganella morganii S5 fliQ flagellar biosynthesis protein FliQ
PMI_RS08015 PMI_RS08015 69.7 Proteus mirabilis HI4320 fliQ flagellar biosynthesis protein FliQ

Distribution of the homologs in the orthogroup group_461

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_461

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1L5 4.84e-34 115 75 0 89 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1L6 4.84e-34 115 75 0 89 1 fliQ Flagellar biosynthetic protein FliQ Salmonella typhi
P57185 7.1e-33 112 65 0 88 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AZ1 9.6e-31 106 60 0 87 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P34201 4.37e-30 105 78 0 89 3 fliQ Flagellar biosynthetic protein FliQ Pectobacterium carotovorum subsp. carotovorum
P0AC10 7.4e-30 104 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Shigella flexneri
P0AC07 7.4e-30 104 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Escherichia coli (strain K12)
P0AC08 7.4e-30 104 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC09 7.4e-30 104 75 0 89 3 fliQ Flagellar biosynthetic protein FliQ Escherichia coli O157:H7
Q8KA36 5.64e-28 99 65 0 88 3 fliQ Flagellar biosynthetic protein FliQ Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0A0S3 3.53e-22 85 54 0 85 3 fliQ Flagellar biosynthetic protein FliQ Helicobacter pylori (strain ATCC 700392 / 26695)
P0A0S4 3.53e-22 85 54 0 85 3 fliQ Flagellar biosynthetic protein FliQ Helicobacter pylori (strain J99 / ATCC 700824)
P35535 2.8e-19 77 44 0 84 3 fliQ Flagellar biosynthetic protein FliQ Bacillus subtilis (strain 168)
O67774 2.44e-15 67 41 0 85 3 fliQ Flagellar biosynthetic protein FliQ Aquifex aeolicus (strain VF5)
P74931 1.8e-14 65 37 0 85 3 fliQ Flagellar biosynthetic protein FliQ Treponema pallidum (strain Nichols)
P0CF98 2.48e-14 65 41 0 74 3 fliQ Flagellar biosynthetic protein FliQ Clostridium tetani (strain Massachusetts / E88)
Q44906 4.5e-12 59 44 0 84 3 fliQ Flagellar biosynthetic protein FliQ Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P69983 2.77e-06 44 31 0 76 3 yscS Yop proteins translocation protein S Yersinia pseudotuberculosis serotype I (strain IP32953)
P69982 2.77e-06 44 31 0 76 3 yscS Yop proteins translocation protein S Yersinia pestis
P74891 2.71e-05 42 31 0 66 3 ssaS Secretion system apparatus protein SsaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q45974 3.32e-05 41 35 0 84 3 fliQ Flagellar biosynthetic protein FliQ Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P55721 0.000229 39 30 0 85 3 NGR_a00600 Probable translocation protein y4yM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0A1L7 0.000778 38 31 0 72 1 spaQ Surface presentation of antigens protein SpaQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1M3 0.000778 38 31 0 72 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhisuis
P0A1L8 0.000778 38 31 0 72 3 spaQ Surface presentation of antigens protein SpaQ Salmonella typhi
P0A1M2 0.000778 38 31 0 72 3 spaQ Surface presentation of antigens protein SpaQ Salmonella senftenberg
P0A1M1 0.000778 38 31 0 72 3 spaQ Surface presentation of antigens protein SpaQ Salmonella gallinarum
P0A1M0 0.000778 38 31 0 72 3 spaQ Surface presentation of antigens protein SpaQ Salmonella enteritidis
P0A1L9 0.000778 38 31 0 72 3 spaQ Surface presentation of antigens protein SpaQ Salmonella dublin

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06655
Feature type CDS
Gene fliQ
Product flagellar biosynthesis protein FliQ
Location 1383956 - 1384225 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_461
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01313 Bacterial export proteins, family 3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1987 Cell motility (N) N Flagellar biosynthesis protein FliQ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02420 flagellar biosynthesis protein FliQ Flagellar assembly -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG002668 flagellar biosynthetic protein FliQ VF0394 Motility

Protein Sequence

MTPESVMALGIEAMKVALMLAAPLLLAALAAGLLISLLQAATQVNEMTLSFIPKILSVISVIVIAGPWMLNLLIDYMRSLLSNLPFIIG

Flanking regions ( +/- flanking 50bp)

CAGTTGCTGCTCGGCTCTCTGTCACAAAGCTTTTTTAACTAGGAGACGTCATGACACCTGAATCCGTTATGGCTCTGGGAATTGAAGCCATGAAAGTGGCGCTGATGCTGGCGGCACCTTTACTGCTTGCCGCCCTTGCGGCAGGTCTGTTGATCAGTTTATTGCAGGCCGCCACCCAGGTAAATGAAATGACATTGTCATTTATCCCGAAAATCCTGTCAGTTATCAGTGTGATCGTGATTGCAGGTCCGTGGATGCTCAATCTGCTCATCGACTATATGCGCAGCCTGTTAAGTAATCTGCCGTTCATTATTGGTTAATCTATGTTAACCATTACCAGCGAAACACTCACATTATGGCTGAGCCAGGG