Homologs in group_577

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01645 FBDBKF_01645 62.4 Morganella morganii S1 pabB aminodeoxychorismate synthase component 1
EHELCC_02115 EHELCC_02115 62.4 Morganella morganii S2 pabB aminodeoxychorismate synthase component 1
NLDBIP_01345 NLDBIP_01345 62.4 Morganella morganii S4 pabB aminodeoxychorismate synthase component 1
LHKJJB_00690 LHKJJB_00690 62.4 Morganella morganii S3 pabB aminodeoxychorismate synthase component 1
HKOGLL_00730 HKOGLL_00730 62.4 Morganella morganii S5 pabB aminodeoxychorismate synthase component 1
F4V73_RS03985 F4V73_RS03985 63.9 Morganella psychrotolerans pabB aminodeoxychorismate synthase component 1

Distribution of the homologs in the orthogroup group_577

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_577

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P05041 0.0 558 60 2 448 1 pabB Aminodeoxychorismate synthase component 1 Escherichia coli (strain K12)
P12680 0.0 557 62 2 443 3 pabB Aminodeoxychorismate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12679 0.0 556 61 2 446 3 pabB Aminodeoxychorismate synthase component 1 Klebsiella aerogenes
P27630 7.48e-99 307 38 6 426 3 pabB Aminodeoxychorismate synthase component 1 Streptomyces lividans
O66849 3.88e-84 270 35 8 466 3 trpE Anthranilate synthase component 1 Aquifex aeolicus (strain VF5)
P14953 6.07e-79 256 32 6 465 3 trpE Anthranilate synthase component 1 Acetivibrio thermocellus
P28820 4.43e-77 251 34 7 438 1 pabB Aminodeoxychorismate synthase component 1 Bacillus subtilis (strain 168)
P27629 3.5e-76 249 35 7 424 3 pabB Aminodeoxychorismate synthase component 1 Lactococcus lactis subsp. lactis
P20170 2.44e-72 240 33 12 474 3 trpE Anthranilate synthase component 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P20579 1.15e-71 238 34 6 389 3 trpE Anthranilate synthase component 1 Pseudomonas putida
P05378 8.17e-71 234 33 7 453 3 trpE Anthranilate synthase component 1 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9X6J4 1.58e-70 235 32 4 451 3 trpE Anthranilate synthase component 1 Geobacillus stearothermophilus
P30526 2.26e-69 232 32 8 457 3 trpE Anthranilate synthase component 1 Bacillus caldotenax
Q5V448 1.01e-68 230 35 3 380 3 trpE1 Anthranilate synthase component 1 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9XJ29 2.11e-68 232 31 13 487 1 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Oryza sativa subsp. japonica
Q02001 3.82e-68 227 34 8 438 3 trpE Anthranilate synthase component 1 Lactococcus lactis subsp. lactis (strain IL1403)
P03963 7.33e-68 228 34 6 423 3 trpE Anthranilate synthase component 1 Bacillus subtilis (strain 168)
P32068 1.38e-67 229 32 9 452 1 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Arabidopsis thaliana
Q9Z4W7 4.01e-67 226 33 6 397 3 trpE Anthranilate synthase component 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q08653 1.15e-66 224 32 6 440 3 trpE Anthranilate synthase component 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P20580 2.58e-66 223 34 3 367 1 trpE Anthranilate synthase component 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A2XNK3 4.15e-66 225 32 10 452 3 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. indica
P21689 4.75e-66 223 34 7 390 3 trpE Anthranilate synthase component 1 Pseudomonas savastanoi
Q94GF1 9.57e-66 224 32 10 452 1 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. japonica
P74130 3.12e-65 221 37 3 362 3 trpE2 Anthranilate synthase component I-like protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5V631 1.24e-64 219 35 6 380 3 trpE3 Anthranilate synthase component 1 3 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P23315 2.42e-64 218 32 12 457 3 trpE Anthranilate synthase component 1 Acinetobacter calcoaceticus
A0QX93 4.02e-64 219 34 4 400 1 trpE Anthranilate synthase component 1 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P32069 1.19e-63 219 30 10 484 2 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Arabidopsis thaliana
P18267 1.3e-63 217 30 6 435 3 trpE Anthranilate synthase component 1 Bacillus pumilus
P32483 2.31e-63 221 38 3 340 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
P26940 8.37e-63 213 31 7 453 3 trpE Anthranilate synthase component 1 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q9X7C5 2.09e-61 211 33 4 404 3 trpE Anthranilate synthase component 1 Mycobacterium leprae (strain TN)
O27692 5.45e-61 209 30 5 430 3 trpE Anthranilate synthase component 1 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9YGB3 1.47e-60 207 31 8 448 3 trpE Anthranilate synthase component 1 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q58475 1.27e-59 205 35 7 371 3 trpE Anthranilate synthase component 1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q06128 2.87e-59 203 35 2 355 1 trpE Anthranilate synthase component 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P9WFX3 3.99e-59 205 34 7 402 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX2 3.99e-59 205 34 7 402 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67002 3.99e-59 205 34 7 402 3 trpE Anthranilate synthase component 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8LPN3 1.9e-57 207 34 8 385 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
F2RB79 2.4e-57 204 32 7 423 1 cmlB Aminodeoxychorismate synthase Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)
Q9S358 3.39e-57 199 29 6 455 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9HS66 3.72e-57 199 32 4 379 3 trpE2 Anthranilate synthase component 1 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P72539 7.5e-57 203 32 9 482 3 papA Aminodeoxychorismate synthase Streptomyces pristinaespiralis
P56995 7.9e-57 198 29 6 455 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9XAZ0 1.24e-56 198 29 6 455 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P96556 1.29e-56 199 31 4 372 3 trpE Anthranilate synthase component 1 Arthrobacter globiformis
O94582 1.66e-55 195 30 6 401 1 trp3 Probable anthranilate synthase component 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P95646 1.23e-54 193 32 2 362 3 trpE Anthranilate synthase component 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q5V213 1.87e-54 193 39 1 268 3 trpE2 Anthranilate synthase component 1 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P00899 7.35e-53 188 31 12 449 1 TRP2 Anthranilate synthase component 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5Z856 8.77e-53 194 33 12 437 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
Q6TAS3 2.37e-51 189 39 3 268 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
P21690 6.98e-51 182 28 9 451 3 trpE Anthranilate synthase component 1 Spirochaeta aurantia
P00898 1.34e-49 180 30 12 404 1 trpE Anthranilate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P00895 1.39e-49 180 32 13 404 1 trpE Anthranilate synthase component 1 Escherichia coli (strain K12)
Q9WW00 2.17e-49 179 29 6 455 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae
Q5F8B4 2.17e-49 179 29 6 455 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q44697 9.76e-49 177 33 11 377 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Diuraphis noxia
P42387 6.49e-48 175 33 10 369 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q44691 9.22e-48 175 31 9 376 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Rhopalosiphum padi
Q44689 6.77e-47 172 31 12 423 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Rhopalosiphum maidis
Q8GMH4 1.66e-46 171 30 4 347 1 sgcD 2-amino-4-deoxychorismate synthase Streptomyces globisporus
O94277 6.89e-46 172 30 11 413 3 SPBP8B7.29 Putative aminodeoxychorismate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O28669 9.85e-46 167 30 6 320 3 trpE Anthranilate synthase component 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q89A29 1.32e-45 169 30 9 395 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q44695 3.73e-45 167 28 15 478 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9ZER9 4.69e-45 167 31 8 374 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Pemphigus spyrothecae
Q9KST2 5.79e-45 167 28 11 467 3 trpE Anthranilate synthase component 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P22099 4.03e-44 165 28 10 422 3 trpE Anthranilate synthase component 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P06557 1.29e-43 163 30 9 384 3 trpE Anthranilate synthase component 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9ZES2 4.22e-43 162 31 10 380 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Tetraneura caerulescens
Q44598 2.95e-42 160 30 10 371 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schlechtendalia chinensis
P43761 1.31e-41 158 30 11 383 3 trpE Anthranilate synthase component 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P33975 4.17e-41 157 35 1 270 3 trpE Anthranilate synthase component 1 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9HPG5 8.87e-40 153 28 8 451 3 trpE1 Anthranilate synthase component 1 1 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9Y8T0 1.03e-39 151 35 3 281 3 trpE Anthranilate synthase component 1 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
P00897 2.66e-39 152 27 9 413 1 trpE Anthranilate synthase component 1 Serratia marcescens
P15395 6.63e-39 153 29 7 397 4 trpE(G) Anthranilate synthase Rhizobium meliloti (strain 1021)
P09785 1.52e-38 150 29 9 375 1 phnA Anthranilate synthase component 1, pyocyanine specific Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZJU5 1.95e-36 143 28 10 375 3 trpE Anthranilate synthase component 1 Helicobacter pylori (strain J99 / ATCC 700824)
O25869 2.55e-36 143 27 9 378 3 trpE Anthranilate synthase component 1 Helicobacter pylori (strain ATCC 700392 / 26695)
P20463 1.17e-35 140 27 10 433 3 trpE Anthranilate synthase component 1 Leptospira biflexa
P50872 3.69e-33 136 26 7 425 4 trpE(G) Anthranilate synthase Azospirillum brasilense
P37254 1.99e-30 128 26 11 398 1 ABZ1 Aminodeoxychorismate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q57527 1.7e-24 107 31 11 266 4 HI_1170 Uncharacterized PabA-like protein HI_1170 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CKY6 5.7e-20 94 31 9 264 4 PM1464 Uncharacterized PabA-like protein PM1464 Pasteurella multocida (strain Pm70)
Q51508 6.83e-20 95 27 6 292 1 pchA Salicylate biosynthesis isochorismate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P23973 1.54e-18 91 28 1 200 3 menF Isochorismate synthase MenF Bacillus subtilis (strain 168)
Q73XV3 6.22e-18 89 26 5 270 3 mbtI Salicylate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P44613 1.48e-16 85 27 3 210 3 menF Isochorismate synthase MenF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WFW9 1.58e-16 84 34 5 205 1 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFW8 1.58e-16 84 34 5 205 3 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P45744 4.6e-15 80 28 2 205 1 dhbC Isochorismate synthase DhbC Bacillus subtilis (strain 168)
P38051 9.6e-14 76 29 9 225 1 menF Isochorismate synthase MenF Escherichia coli (strain K12)
P0AEJ2 1.43e-13 75 27 5 218 1 entC Isochorismate synthase EntC Escherichia coli (strain K12)
P0AEJ3 1.43e-13 75 27 5 218 3 entC Isochorismate synthase EntC Escherichia coli O157:H7
P9WFX1 4.04e-12 71 27 4 249 1 mbtI Salicylate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX0 4.04e-12 71 27 4 249 3 mbtI Salicylate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TYQ1 4.04e-12 71 27 4 249 3 mbtI Salicylate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CPI5 6.25e-12 70 24 6 223 3 menF Isochorismate synthase MenF Pasteurella multocida (strain Pm70)
P23300 5.96e-10 64 25 3 203 3 amoA Putative isochorismate synthase Aeromonas hydrophila
Q9S7H8 8.95e-10 64 28 4 194 1 ICS1 Isochorismate synthase 1, chloroplastic Arabidopsis thaliana
Q9M9V6 3.68e-09 62 26 3 197 1 ICS2 Isochorismate synthase 2, chloroplastic Arabidopsis thaliana
O07898 1.72e-08 60 23 3 199 3 vibC Vibriobactin-specific isochorismate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZPC0 5.86e-06 52 20 10 352 1 None Isochorismate synthase, chloroplastic Catharanthus roseus
Q51519 0.000189 47 23 8 282 4 phzB Anthranilate synthase, phenazine specific Pseudomonas chlororaphis

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07835
Feature type CDS
Gene pabB
Product aminodeoxychorismate synthase component 1
Location 1715008 - 1716402 (strand: 1)
Length 1395 (nucleotides) / 464 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_577
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00425 chorismate binding enzyme
PF04715 Anthranilate synthase component I, N terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0147 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)		 EH Anthranilate/para-aminobenzoate synthases component I

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01665 para-aminobenzoate synthetase component I [EC:2.6.1.85] Folate biosynthesis
Biosynthesis of cofactors		 -

Protein Sequence

MDMQLQQRELTYTPDLALRVFAPIASLSWSSLLHSGFAEHHHNRFDIVVSDPAITLETRKQITTIKEKTGRVKRSKKDPFTLIQTALDAFNFHPVSDETLPFLGGALGIWSYDLGRRIEILPELAKNELNFADMAIGIYDWALIVDHQLKKATLISYQDIDARLQWLAKHADNNTIEKKEPFVLTSPWQSNMSSDEYNEKIAKIHQYLLSGDCYQVNLAQRFCANYSGDEWNAFLTLNQANKAPFSAFMHLPHHFVMSISPERFIHLSDHKIETRPIKGTLPRKAHPDEDDEQAQLLANSRKDRAENLMIVDLMRNDIGKVATTGSVKVPELFVVERFPAVHHLVSTITAELPENLNATDLLRAAFPGGSITGAPKIRAMEIIEELEPHRRHGYCGAIGYISFCGTMDTNISIRTLLTEKNKIYCWAGGGIVADSVAEQEYQETFDKLGQILTVLSEVSPDDTY

Flanking regions ( +/- flanking 50bp)

AATGATTGATAGTGTAAATGATACAGAATACTTGTTTAAATGGTCATAAAATGGATATGCAATTACAGCAACGTGAATTAACTTATACCCCTGATTTAGCATTACGGGTATTTGCACCTATCGCCTCTTTGTCTTGGTCTAGTTTACTGCATTCAGGTTTTGCCGAACATCACCATAATCGTTTTGATATTGTTGTATCCGATCCTGCTATTACCTTAGAAACACGCAAACAAATTACCACTATTAAAGAGAAAACCGGTCGAGTCAAACGCTCTAAAAAAGATCCCTTTACGCTTATCCAAACAGCATTAGACGCTTTTAATTTTCATCCAGTCAGTGATGAAACGCTTCCTTTTCTAGGTGGCGCATTAGGTATATGGAGTTACGATTTAGGTCGTCGCATTGAAATATTACCAGAATTAGCAAAAAATGAACTTAATTTCGCTGATATGGCTATCGGTATTTATGATTGGGCACTAATTGTTGACCATCAACTGAAAAAAGCCACATTAATAAGCTACCAAGATATTGACGCACGTCTCCAATGGCTAGCAAAGCACGCTGATAATAACACAATAGAAAAAAAAGAACCTTTTGTCTTAACTTCTCCATGGCAATCAAACATGAGTAGTGATGAATACAATGAAAAAATTGCTAAAATTCATCAATACTTACTTTCAGGGGATTGCTATCAAGTCAATTTAGCGCAACGTTTTTGTGCTAATTATAGCGGTGATGAATGGAATGCATTTTTAACACTAAATCAAGCGAATAAAGCACCATTTTCTGCTTTTATGCATTTACCTCATCATTTTGTTATGAGTATTTCTCCTGAACGTTTTATTCATTTAAGTGATCATAAAATTGAAACACGTCCAATAAAGGGTACCCTTCCCCGTAAAGCGCATCCCGATGAAGATGATGAACAAGCGCAATTGCTGGCAAATTCTCGTAAAGATCGTGCTGAAAACTTAATGATTGTCGATTTAATGCGCAATGATATTGGTAAAGTTGCCACAACAGGATCAGTCAAAGTACCTGAATTATTCGTTGTTGAACGCTTTCCCGCCGTACACCACTTAGTCAGCACCATTACCGCTGAACTTCCAGAAAATTTAAACGCAACTGACTTATTACGTGCGGCCTTCCCCGGTGGCTCCATTACTGGCGCACCTAAAATTAGAGCAATGGAGATTATCGAAGAACTAGAGCCACATCGTCGCCATGGATATTGTGGTGCCATTGGCTATATTAGTTTTTGTGGTACGATGGATACTAATATCTCAATTAGAACCCTACTGACGGAAAAAAATAAAATTTACTGTTGGGCGGGGGGTGGAATTGTCGCTGATAGCGTTGCCGAACAAGAGTACCAAGAAACCTTTGATAAACTTGGTCAAATATTAACTGTTTTAAGTGAAGTTTCTCCCGATGACACTTATTGATACCTTTATCAATCGCTTTCAACTTACTTTACCTGAGCCGGTAAATCAGC