Homologs in group_577

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01645 FBDBKF_01645 83.4 Morganella morganii S1 pabB aminodeoxychorismate synthase component 1
EHELCC_02115 EHELCC_02115 83.4 Morganella morganii S2 pabB aminodeoxychorismate synthase component 1
NLDBIP_01345 NLDBIP_01345 83.4 Morganella morganii S4 pabB aminodeoxychorismate synthase component 1
LHKJJB_00690 LHKJJB_00690 83.4 Morganella morganii S3 pabB aminodeoxychorismate synthase component 1
HKOGLL_00730 HKOGLL_00730 83.4 Morganella morganii S5 pabB aminodeoxychorismate synthase component 1
PMI_RS07835 PMI_RS07835 63.9 Proteus mirabilis HI4320 pabB aminodeoxychorismate synthase component 1

Distribution of the homologs in the orthogroup group_577

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_577

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12679 0.0 553 61 5 449 3 pabB Aminodeoxychorismate synthase component 1 Klebsiella aerogenes
P12680 0.0 549 61 4 454 3 pabB Aminodeoxychorismate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P05041 0.0 541 59 4 451 1 pabB Aminodeoxychorismate synthase component 1 Escherichia coli (strain K12)
P27630 6.12e-86 274 38 5 423 3 pabB Aminodeoxychorismate synthase component 1 Streptomyces lividans
Q9Z4W7 9.99e-78 254 39 7 391 3 trpE Anthranilate synthase component 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O66849 3.11e-76 249 33 7 466 3 trpE Anthranilate synthase component 1 Aquifex aeolicus (strain VF5)
P28820 3.19e-76 249 34 7 416 1 pabB Aminodeoxychorismate synthase component 1 Bacillus subtilis (strain 168)
P27629 1.43e-75 247 35 6 431 3 pabB Aminodeoxychorismate synthase component 1 Lactococcus lactis subsp. lactis
P05378 2.39e-75 246 37 11 440 3 trpE Anthranilate synthase component 1 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P18267 2.44e-73 242 32 7 450 3 trpE Anthranilate synthase component 1 Bacillus pumilus
P14953 1.18e-71 238 29 6 460 3 trpE Anthranilate synthase component 1 Acetivibrio thermocellus
Q02001 3.04e-71 235 33 8 440 3 trpE Anthranilate synthase component 1 Lactococcus lactis subsp. lactis (strain IL1403)
P20579 1.18e-70 235 32 7 449 3 trpE Anthranilate synthase component 1 Pseudomonas putida
P20170 3.29e-70 234 34 10 458 3 trpE Anthranilate synthase component 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P74130 1.08e-69 232 38 4 360 3 trpE2 Anthranilate synthase component I-like protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P20580 1.16e-69 232 33 8 450 1 trpE Anthranilate synthase component 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P23315 5.77e-69 230 32 10 453 3 trpE Anthranilate synthase component 1 Acinetobacter calcoaceticus
P03963 3.14e-68 229 29 10 501 3 trpE Anthranilate synthase component 1 Bacillus subtilis (strain 168)
P21689 2.44e-66 224 31 7 454 3 trpE Anthranilate synthase component 1 Pseudomonas savastanoi
A0QX93 4.42e-66 224 34 7 471 1 trpE Anthranilate synthase component 1 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9X7C5 7.61e-66 223 34 7 472 3 trpE Anthranilate synthase component 1 Mycobacterium leprae (strain TN)
Q9X6J4 1.37e-65 222 32 6 445 3 trpE Anthranilate synthase component 1 Geobacillus stearothermophilus
P30526 2.06e-65 221 31 7 452 3 trpE Anthranilate synthase component 1 Bacillus caldotenax
Q5V448 6.33e-64 217 37 7 375 3 trpE1 Anthranilate synthase component 1 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P9WFX3 1.55e-62 214 33 7 474 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX2 1.55e-62 214 33 7 474 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67002 1.55e-62 214 33 7 474 3 trpE Anthranilate synthase component 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
F2RB79 1.78e-62 218 35 11 442 1 cmlB Aminodeoxychorismate synthase Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)
P96556 2.84e-62 214 33 12 460 3 trpE Anthranilate synthase component 1 Arthrobacter globiformis
Q9XJ29 7.33e-62 214 31 11 452 1 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Oryza sativa subsp. japonica
P32483 5.93e-61 214 37 7 406 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
Q9S358 3.08e-60 207 34 4 361 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P32069 3.87e-60 210 32 13 463 2 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Arabidopsis thaliana
Q9YGB3 4.32e-60 205 31 9 449 3 trpE Anthranilate synthase component 1 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P56995 8.17e-60 206 33 4 361 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q08653 8.34e-60 205 33 7 384 3 trpE Anthranilate synthase component 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P32068 1.16e-59 208 29 9 460 1 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Arabidopsis thaliana
Q9XAZ0 1.42e-59 206 30 7 462 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A2XNK3 2.06e-59 207 30 11 452 3 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. indica
Q5V631 2.12e-59 205 35 7 374 3 trpE3 Anthranilate synthase component 1 3 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q8LPN3 6.13e-59 211 36 9 370 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
Q94GF1 3.05e-58 204 30 11 452 1 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. japonica
P21690 3.13e-56 196 29 7 456 3 trpE Anthranilate synthase component 1 Spirochaeta aurantia
Q9HS66 1.28e-55 195 35 5 368 3 trpE2 Anthranilate synthase component 1 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P00899 5.62e-55 194 30 12 477 1 TRP2 Anthranilate synthase component 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q06128 2.04e-53 187 34 6 371 1 trpE Anthranilate synthase component 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q58475 5.29e-53 187 32 6 368 3 trpE Anthranilate synthase component 1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P72539 6.13e-53 192 39 7 328 3 papA Aminodeoxychorismate synthase Streptomyces pristinaespiralis
Q6TAS3 1.23e-52 193 35 7 343 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
Q9WW00 3.63e-52 186 31 9 463 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae
Q5F8B4 3.63e-52 186 31 9 463 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
O27692 7.63e-52 184 30 7 427 3 trpE Anthranilate synthase component 1 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8GMH4 2.36e-51 184 32 3 352 1 sgcD 2-amino-4-deoxychorismate synthase Streptomyces globisporus
Q5Z856 2.95e-51 189 33 11 387 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
P95646 3.23e-51 184 34 5 371 3 trpE Anthranilate synthase component 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P26940 4.23e-51 182 30 7 420 3 trpE Anthranilate synthase component 1 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O94582 7.62e-51 182 30 8 393 1 trp3 Probable anthranilate synthase component 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5V213 1.29e-50 182 32 10 440 3 trpE2 Anthranilate synthase component 1 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q44697 1.71e-49 179 32 7 363 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Diuraphis noxia
Q9ZER9 1.93e-49 179 31 10 406 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Pemphigus spyrothecae
P06557 7.99e-49 177 34 9 368 3 trpE Anthranilate synthase component 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P00898 1.17e-47 174 31 10 393 1 trpE Anthranilate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P00895 1.43e-47 174 32 9 392 1 trpE Anthranilate synthase component 1 Escherichia coli (strain K12)
P09785 3.9e-47 173 32 6 358 1 phnA Anthranilate synthase component 1, pyocyanine specific Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44695 8.32e-47 172 32 9 363 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q44689 7.05e-46 169 32 11 357 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Rhopalosiphum maidis
Q44691 2.69e-44 165 31 8 357 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Rhopalosiphum padi
P42387 2.49e-43 162 31 8 358 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O28669 3.73e-43 160 28 15 443 3 trpE Anthranilate synthase component 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q44598 1.93e-42 160 29 7 369 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schlechtendalia chinensis
O25869 3.7e-42 159 30 10 378 3 trpE Anthranilate synthase component 1 Helicobacter pylori (strain ATCC 700392 / 26695)
P43761 4.13e-42 159 28 10 412 3 trpE Anthranilate synthase component 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P33975 6.11e-42 159 30 9 456 3 trpE Anthranilate synthase component 1 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9ZJU5 8.32e-42 158 29 11 403 3 trpE Anthranilate synthase component 1 Helicobacter pylori (strain J99 / ATCC 700824)
Q89A29 2.09e-41 157 29 12 401 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P00897 3.37e-41 157 30 8 377 1 trpE Anthranilate synthase component 1 Serratia marcescens
P22099 8.06e-41 156 29 11 411 3 trpE Anthranilate synthase component 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O94277 8.39e-41 158 30 9 380 3 SPBP8B7.29 Putative aminodeoxychorismate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9HPG5 4.55e-40 154 28 9 447 3 trpE1 Anthranilate synthase component 1 1 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9Y8T0 3.5e-39 150 37 3 264 3 trpE Anthranilate synthase component 1 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q9KST2 4.75e-39 151 28 10 411 3 trpE Anthranilate synthase component 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZES2 1.22e-38 150 29 9 374 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Tetraneura caerulescens
P20463 8.04e-34 135 28 8 364 3 trpE Anthranilate synthase component 1 Leptospira biflexa
P15395 1.42e-31 131 30 4 334 4 trpE(G) Anthranilate synthase Rhizobium meliloti (strain 1021)
P50872 6.35e-29 123 32 2 247 4 trpE(G) Anthranilate synthase Azospirillum brasilense
P37254 2.26e-28 122 26 12 399 1 ABZ1 Aminodeoxychorismate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9CKY6 5.31e-25 108 31 11 291 4 PM1464 Uncharacterized PabA-like protein PM1464 Pasteurella multocida (strain Pm70)
Q57527 5.62e-25 108 29 8 270 4 HI_1170 Uncharacterized PabA-like protein HI_1170 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q73XV3 6.62e-24 107 27 2 263 3 mbtI Salicylate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q51508 7.94e-21 98 29 4 278 1 pchA Salicylate biosynthesis isochorismate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WFX1 5.52e-18 89 28 3 263 1 mbtI Salicylate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX0 5.52e-18 89 28 3 263 3 mbtI Salicylate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TYQ1 5.52e-18 89 28 3 263 3 mbtI Salicylate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0AEJ2 5.22e-17 86 28 3 221 1 entC Isochorismate synthase EntC Escherichia coli (strain K12)
P0AEJ3 5.22e-17 86 28 3 221 3 entC Isochorismate synthase EntC Escherichia coli O157:H7
P45744 2e-15 81 32 4 200 1 dhbC Isochorismate synthase DhbC Bacillus subtilis (strain 168)
P44613 5.41e-15 80 25 4 213 3 menF Isochorismate synthase MenF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23973 1.25e-14 79 28 2 200 3 menF Isochorismate synthase MenF Bacillus subtilis (strain 168)
P23300 4.16e-14 77 26 6 273 3 amoA Putative isochorismate synthase Aeromonas hydrophila
P9WFW9 5.95e-14 76 31 9 279 1 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFW8 5.95e-14 76 31 9 279 3 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07898 3.16e-12 71 25 3 199 3 vibC Vibriobactin-specific isochorismate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CPI5 2.67e-11 68 26 4 209 3 menF Isochorismate synthase MenF Pasteurella multocida (strain Pm70)
P38051 3.4e-11 68 27 6 205 1 menF Isochorismate synthase MenF Escherichia coli (strain K12)
Q9M9V6 3.37e-09 62 26 4 203 1 ICS2 Isochorismate synthase 2, chloroplastic Arabidopsis thaliana
Q9S7H8 6.73e-08 58 28 5 192 1 ICS1 Isochorismate synthase 1, chloroplastic Arabidopsis thaliana
Q9ZPC0 4.34e-07 55 25 5 204 1 None Isochorismate synthase, chloroplastic Catharanthus roseus
Q51519 1.83e-06 53 24 9 281 4 phzB Anthranilate synthase, phenazine specific Pseudomonas chlororaphis
Q51791 2.44e-06 53 25 10 283 4 phzE Anthranilate synthase, phenazine specific Pseudomonas fluorescens

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03985
Feature type CDS
Gene pabB
Product aminodeoxychorismate synthase component 1
Location 845678 - 847060 (strand: -1)
Length 1383 (nucleotides) / 460 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_577
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00425 chorismate binding enzyme
PF04715 Anthranilate synthase component I, N terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0147 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)		 EH Anthranilate/para-aminobenzoate synthases component I

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01665 para-aminobenzoate synthetase component I [EC:2.6.1.85] Folate biosynthesis
Biosynthesis of cofactors		 -

Protein Sequence

MTQHSIPVLTPLDYHPGLAVTLFAPLAHLPQAVLLHSGDAQHQHNRFDILTADPVMTLTTRGDDTVTEDNRGQSVCQKSDPFRLLDDALAQCGFSPCPQDDYPFMGGALGLWGYDLGRRTESLPSLARNELNIPDMAVGLYDWAIIVDNHRRCATLITYDDPAARLAWLQIQRDAAPAQAVPFALTGGWQSDMSEAEYHEKIARIHEYLQAGDCYQVNLAQRFTAPYEGDEWQAFLLLNAENKAPFSAFLRLADAAVISVSPERFLSLKNGTVQTRPIKGTRPRHPEDAQADEKEKQALAASEKDRAENLMIVDLMRNDIGRVARPGSVSVPSLFAVEAFPAVYHLVSTITAELPPQCHAADLLRACFPGGSITGAPKIRAMEIIEELEPYRRHSYCGSIGYISFCGTMDTNIAIRTLIAEDNRLYCKAGGGIVADSRAADEYQETFDKLGRILPVLPEK

Flanking regions ( +/- flanking 50bp)

TAAGATAGTGCGATGTTTTCCTGAGAATTCGTTTACTGACAGACCAAATCATGACACAACATTCAATACCTGTACTGACACCGCTTGATTACCATCCCGGACTTGCCGTCACGCTGTTCGCGCCGCTGGCTCATCTGCCACAGGCTGTGCTGCTGCACTCGGGTGATGCTCAGCATCAGCATAACCGCTTTGATATTCTGACAGCCGACCCGGTAATGACCCTGACGACCCGGGGCGATGATACCGTTACTGAAGATAACCGGGGTCAGTCTGTCTGTCAGAAAAGTGATCCGTTCCGATTACTTGACGATGCCCTGGCGCAGTGCGGGTTTTCTCCCTGCCCGCAGGATGATTATCCGTTTATGGGGGGCGCACTCGGGCTGTGGGGATATGACCTCGGACGCCGCACAGAATCCCTGCCGTCACTGGCACGTAATGAACTCAATATTCCGGATATGGCAGTGGGTTTGTATGACTGGGCTATCATTGTGGACAACCATCGCCGCTGTGCCACACTGATTACTTATGACGATCCTGCTGCGCGTCTTGCGTGGTTACAGATACAGCGGGACGCAGCCCCCGCGCAGGCTGTTCCGTTTGCACTGACCGGCGGTTGGCAGTCAGACATGAGTGAGGCGGAATATCATGAGAAAATCGCCCGTATTCATGAGTATCTGCAGGCCGGGGACTGCTATCAGGTGAATCTGGCACAACGTTTCACCGCCCCTTATGAAGGGGATGAATGGCAGGCGTTTCTTTTGCTGAATGCAGAAAATAAAGCGCCGTTCTCTGCATTTCTGCGCCTGGCGGATGCAGCGGTTATCTCTGTTTCACCGGAGCGCTTCCTGTCGCTGAAAAACGGCACAGTGCAGACACGTCCGATAAAAGGTACCCGTCCGCGCCACCCGGAAGATGCACAGGCTGATGAGAAAGAAAAACAGGCTCTTGCCGCATCCGAAAAAGACCGCGCCGAGAACCTGATGATTGTTGACCTGATGCGCAATGATATCGGACGGGTTGCACGACCGGGCTCTGTCAGTGTGCCGTCACTGTTTGCCGTCGAGGCATTTCCGGCTGTGTATCATCTGGTCAGTACCATTACCGCCGAATTACCGCCGCAATGCCATGCGGCTGATTTACTGCGCGCCTGCTTTCCGGGTGGATCAATTACCGGCGCGCCGAAAATCCGTGCGATGGAAATTATTGAAGAGCTGGAACCTTACCGCCGACATTCCTATTGCGGGTCAATCGGCTATATTAGTTTCTGCGGAACCATGGATACCAATATTGCTATCCGTACCCTGATTGCCGAAGACAACCGGCTTTACTGCAAAGCGGGTGGCGGTATTGTGGCAGACAGCCGCGCCGCAGATGAATATCAGGAAACATTCGATAAACTGGGGCGGATTTTACCCGTTCTGCCGGAGAAATAACTCATGAATTCACTGGCGCAGTTTATCCCCCGTTTTCAGTTAATCCGCCC