Homologs in group_577

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02115 EHELCC_02115 100.0 Morganella morganii S2 pabB aminodeoxychorismate synthase component 1
NLDBIP_01345 NLDBIP_01345 100.0 Morganella morganii S4 pabB aminodeoxychorismate synthase component 1
LHKJJB_00690 LHKJJB_00690 100.0 Morganella morganii S3 pabB aminodeoxychorismate synthase component 1
HKOGLL_00730 HKOGLL_00730 100.0 Morganella morganii S5 pabB aminodeoxychorismate synthase component 1
F4V73_RS03985 F4V73_RS03985 83.4 Morganella psychrotolerans pabB aminodeoxychorismate synthase component 1
PMI_RS07835 PMI_RS07835 62.4 Proteus mirabilis HI4320 pabB aminodeoxychorismate synthase component 1

Distribution of the homologs in the orthogroup group_577

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_577

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12679 0.0 563 62 3 449 3 pabB Aminodeoxychorismate synthase component 1 Klebsiella aerogenes
P12680 0.0 555 62 2 445 3 pabB Aminodeoxychorismate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P05041 0.0 550 60 2 448 1 pabB Aminodeoxychorismate synthase component 1 Escherichia coli (strain K12)
P27630 1.66e-91 288 39 8 424 3 pabB Aminodeoxychorismate synthase component 1 Streptomyces lividans
P28820 1.22e-74 244 34 8 417 1 pabB Aminodeoxychorismate synthase component 1 Bacillus subtilis (strain 168)
Q9Z4W7 2.49e-73 242 37 6 398 3 trpE Anthranilate synthase component 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P27629 4.35e-73 240 36 7 422 3 pabB Aminodeoxychorismate synthase component 1 Lactococcus lactis subsp. lactis
P20579 1.8e-70 234 34 8 449 3 trpE Anthranilate synthase component 1 Pseudomonas putida
P05378 6.81e-69 229 37 10 426 3 trpE Anthranilate synthase component 1 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P18267 1.41e-68 230 32 8 462 3 trpE Anthranilate synthase component 1 Bacillus pumilus
P20580 2.05e-68 229 34 8 450 1 trpE Anthranilate synthase component 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O66849 1.46e-67 227 31 7 466 3 trpE Anthranilate synthase component 1 Aquifex aeolicus (strain VF5)
P14953 2.44e-67 226 28 7 467 3 trpE Anthranilate synthase component 1 Acetivibrio thermocellus
P21689 2.65e-67 226 33 7 453 3 trpE Anthranilate synthase component 1 Pseudomonas savastanoi
P74130 5.26e-66 222 38 6 362 3 trpE2 Anthranilate synthase component I-like protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P20170 5.94e-65 220 34 9 460 3 trpE Anthranilate synthase component 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P03963 1.04e-64 220 29 7 482 3 trpE Anthranilate synthase component 1 Bacillus subtilis (strain 168)
Q02001 3.28e-63 214 30 9 440 3 trpE Anthranilate synthase component 1 Lactococcus lactis subsp. lactis (strain IL1403)
P23315 6.47e-63 214 32 12 452 3 trpE Anthranilate synthase component 1 Acinetobacter calcoaceticus
Q9X7C5 1.03e-62 215 33 7 472 3 trpE Anthranilate synthase component 1 Mycobacterium leprae (strain TN)
A0QX93 1.5e-62 214 34 8 475 1 trpE Anthranilate synthase component 1 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9X6J4 3.03e-61 210 31 7 469 3 trpE Anthranilate synthase component 1 Geobacillus stearothermophilus
Q5V448 1.02e-60 209 36 6 374 3 trpE1 Anthranilate synthase component 1 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P32483 1.65e-60 213 38 5 374 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
P9WFX3 2.69e-60 208 33 7 471 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX2 2.69e-60 208 33 7 471 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67002 2.69e-60 208 33 7 471 3 trpE Anthranilate synthase component 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8LPN3 8.02e-60 213 34 10 408 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
Q9YGB3 1.11e-59 204 32 11 451 3 trpE Anthranilate synthase component 1 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9S358 5.41e-59 204 31 9 446 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P56995 2.11e-58 202 30 9 446 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9XAZ0 4.12e-58 202 30 9 446 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P72539 6.28e-58 206 37 10 409 3 papA Aminodeoxychorismate synthase Streptomyces pristinaespiralis
P32069 8.46e-58 204 31 10 461 2 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Arabidopsis thaliana
P21690 1.11e-57 200 31 10 455 3 trpE Anthranilate synthase component 1 Spirochaeta aurantia
F2RB79 1.74e-57 204 34 11 450 1 cmlB Aminodeoxychorismate synthase Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)
P30526 4.53e-57 199 29 7 469 3 trpE Anthranilate synthase component 1 Bacillus caldotenax
Q5V631 5.57e-57 199 35 7 376 3 trpE3 Anthranilate synthase component 1 3 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q9XJ29 6.79e-57 201 30 11 452 1 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Oryza sativa subsp. japonica
Q06128 9.66e-57 196 33 4 380 1 trpE Anthranilate synthase component 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P32068 1.09e-56 200 29 9 460 1 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Arabidopsis thaliana
A2XNK3 1.06e-54 194 29 10 463 3 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. indica
Q08653 4.26e-54 190 31 9 429 3 trpE Anthranilate synthase component 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P96556 5.73e-54 192 31 8 452 3 trpE Anthranilate synthase component 1 Arthrobacter globiformis
Q94GF1 1.03e-53 192 28 10 463 1 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. japonica
P95646 6.18e-53 188 31 6 442 3 trpE Anthranilate synthase component 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9HS66 2.01e-52 186 34 4 374 3 trpE2 Anthranilate synthase component 1 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O27692 2.61e-52 186 30 6 429 3 trpE Anthranilate synthase component 1 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5Z856 5.95e-52 191 33 12 429 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
Q6TAS3 1.89e-51 190 31 8 410 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
Q9ZER9 5.59e-51 183 32 9 389 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Pemphigus spyrothecae
Q9WW00 1.01e-50 182 30 9 446 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae
Q5F8B4 1.01e-50 182 30 9 446 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P26940 1.78e-50 181 29 6 423 3 trpE Anthranilate synthase component 1 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P00899 1.12e-48 177 29 12 473 1 TRP2 Anthranilate synthase component 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q58475 2.64e-48 175 32 7 356 3 trpE Anthranilate synthase component 1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8GMH4 4.89e-48 175 32 4 350 1 sgcD 2-amino-4-deoxychorismate synthase Streptomyces globisporus
O94582 2.33e-47 173 30 7 399 1 trp3 Probable anthranilate synthase component 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q44697 4.26e-47 173 31 8 366 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Diuraphis noxia
Q44695 1.36e-46 171 29 7 372 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P00895 1.46e-46 171 33 12 397 1 trpE Anthranilate synthase component 1 Escherichia coli (strain K12)
P00898 3.02e-46 171 32 7 365 1 trpE Anthranilate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5V213 1.29e-45 169 32 11 440 3 trpE2 Anthranilate synthase component 1 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q44689 2.2e-45 168 30 8 365 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Rhopalosiphum maidis
P09785 9.09e-45 167 30 5 358 1 phnA Anthranilate synthase component 1, pyocyanine specific Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44691 9.73e-45 166 30 8 366 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Rhopalosiphum padi
Q44598 1.57e-44 166 31 7 367 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schlechtendalia chinensis
P06557 4.81e-44 164 31 9 371 3 trpE Anthranilate synthase component 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9KST2 2.55e-43 162 30 11 421 3 trpE Anthranilate synthase component 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZJU5 4.69e-43 161 27 9 404 3 trpE Anthranilate synthase component 1 Helicobacter pylori (strain J99 / ATCC 700824)
P42387 2.4e-42 160 30 7 366 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O94277 3.83e-42 162 31 9 385 3 SPBP8B7.29 Putative aminodeoxychorismate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q89A29 1.02e-41 158 29 9 367 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O28669 1.55e-41 155 28 12 432 3 trpE Anthranilate synthase component 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O25869 1.64e-41 157 28 8 383 3 trpE Anthranilate synthase component 1 Helicobacter pylori (strain ATCC 700392 / 26695)
P00897 2.32e-41 157 31 8 365 1 trpE Anthranilate synthase component 1 Serratia marcescens
P22099 3.34e-41 157 29 10 411 3 trpE Anthranilate synthase component 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P43761 9.8e-40 152 28 6 365 3 trpE Anthranilate synthase component 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9Y8T0 1.17e-39 151 37 3 262 3 trpE Anthranilate synthase component 1 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q9HPG5 1.59e-39 152 29 12 473 3 trpE1 Anthranilate synthase component 1 1 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9ZES2 2.14e-39 152 29 11 383 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Tetraneura caerulescens
P33975 2.82e-37 146 29 10 458 3 trpE Anthranilate synthase component 1 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P20463 5.53e-34 135 28 9 361 3 trpE Anthranilate synthase component 1 Leptospira biflexa
P37254 7.51e-32 132 28 13 404 1 ABZ1 Aminodeoxychorismate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P15395 1.28e-26 116 30 4 333 4 trpE(G) Anthranilate synthase Rhizobium meliloti (strain 1021)
P50872 1.86e-26 116 29 6 342 4 trpE(G) Anthranilate synthase Azospirillum brasilense
Q57527 6.41e-24 105 29 9 280 4 HI_1170 Uncharacterized PabA-like protein HI_1170 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CKY6 4.96e-23 102 30 10 298 4 PM1464 Uncharacterized PabA-like protein PM1464 Pasteurella multocida (strain Pm70)
Q73XV3 3.47e-20 96 28 4 257 3 mbtI Salicylate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q51508 3.85e-19 93 28 7 308 1 pchA Salicylate biosynthesis isochorismate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WFX1 4.86e-18 89 30 4 255 1 mbtI Salicylate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX0 4.86e-18 89 30 4 255 3 mbtI Salicylate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TYQ1 4.86e-18 89 30 4 255 3 mbtI Salicylate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFW9 5.42e-16 82 32 8 276 1 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFW8 5.42e-16 82 32 8 276 3 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P23300 1.68e-15 81 27 8 277 3 amoA Putative isochorismate synthase Aeromonas hydrophila
P0AEJ2 2.01e-14 78 28 3 222 1 entC Isochorismate synthase EntC Escherichia coli (strain K12)
P0AEJ3 2.01e-14 78 28 3 222 3 entC Isochorismate synthase EntC Escherichia coli O157:H7
P45744 8.48e-14 76 28 6 266 1 dhbC Isochorismate synthase DhbC Bacillus subtilis (strain 168)
P23973 1.93e-13 75 25 2 220 3 menF Isochorismate synthase MenF Bacillus subtilis (strain 168)
P44613 2.62e-13 75 27 5 203 3 menF Isochorismate synthase MenF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38051 5.19e-11 68 28 4 204 1 menF Isochorismate synthase MenF Escherichia coli (strain K12)
O07898 3.82e-10 65 26 4 200 3 vibC Vibriobactin-specific isochorismate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9M9V6 2.45e-08 60 26 5 223 1 ICS2 Isochorismate synthase 2, chloroplastic Arabidopsis thaliana
Q9CPI5 2.68e-08 59 26 7 212 3 menF Isochorismate synthase MenF Pasteurella multocida (strain Pm70)
Q51791 3.34e-08 59 25 9 283 4 phzE Anthranilate synthase, phenazine specific Pseudomonas fluorescens
Q51519 4.05e-08 59 24 8 281 4 phzB Anthranilate synthase, phenazine specific Pseudomonas chlororaphis
Q9ZPC0 6.28e-06 52 24 4 203 1 None Isochorismate synthase, chloroplastic Catharanthus roseus
Q9S7H8 6.49e-06 52 25 4 191 1 ICS1 Isochorismate synthase 1, chloroplastic Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01645
Feature type CDS
Gene pabB
Product aminodeoxychorismate synthase component 1
Location 22631 - 24010 (strand: -1)
Length 1380 (nucleotides) / 459 (amino acids)

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_577
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00425 chorismate binding enzyme
PF04715 Anthranilate synthase component I, N terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0147 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)		 EH Anthranilate/para-aminobenzoate synthases component I

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01665 para-aminobenzoate synthetase component I [EC:2.6.1.85] Folate biosynthesis
Biosynthesis of cofactors		 -

Protein Sequence

MTSHSVPVLTPLDYHPGLALTLFAPLSHQPWAMLLHSGSAQHQHNRFDILTADPLMTLTTRGDETLTEDSRGQRVRQNDDPFQLLDAALAQCGLNPQPHDDYPFAGGAMGLWGYDLGRRTESLPSLARNELSVPDMAIGIYDWAVIVDHQRRCATLITYTDPAARLHWLENQKAPESLPFALTGHWQSDMTEAEYHEKIARIHDYLQAGDCYQVNLSQGFSAPYEGDEWQAFLRLNDENRAPFSAFLRLPEAAILSVSPERFLWLKDGTAETRPIKGTRPRHPADPQADEAEKQALAASEKDRSENLMIVDLMRNDIGRVALPGSVSVPSLFAVEPFPAVWHLVSTITAQLPAACRAAQLLRACFPGGSITGAPKIRAMEIIEELEPVRRHTYCGSVGYISACGTMDTNIAIRTLIAENNHLYCRAGGGIVADSRAADEYQETFDKLGRILTVLPEKIL

Flanking regions ( +/- flanking 50bp)

CGATAAGATAACCGGCAGTTTCCGGACACAGATTACTGACAGACTGAATTATGACATCACATTCCGTACCTGTACTGACACCACTTGACTATCATCCCGGTCTCGCCCTGACCCTGTTTGCCCCGCTGTCGCATCAGCCGTGGGCCATGCTGCTGCACTCCGGCAGTGCTCAGCATCAGCATAACCGCTTTGATATTCTGACCGCCGATCCCCTGATGACACTGACCACCAGAGGCGATGAGACCTTAACTGAAGATAGCCGGGGGCAGCGCGTCCGTCAAAATGATGACCCGTTTCAGTTACTGGATGCGGCGCTGGCACAGTGCGGACTGAATCCTCAACCGCACGATGACTATCCGTTTGCGGGCGGCGCGATGGGATTATGGGGCTATGATCTCGGGCGGCGAACCGAGTCTCTGCCGTCACTGGCACGTAATGAGCTGTCGGTGCCGGATATGGCCATAGGCATTTACGACTGGGCGGTGATTGTTGACCACCAGCGCCGCTGCGCCACATTAATTACCTATACCGATCCCGCCGCGCGTCTGCACTGGCTGGAGAATCAGAAGGCACCGGAGAGTCTGCCTTTCGCCCTGACCGGCCACTGGCAGTCCGATATGACCGAAGCGGAATATCACGAAAAAATTGCCCGTATTCATGACTATCTGCAGGCCGGTGATTGTTATCAGGTCAATCTGTCACAGGGTTTTTCCGCTCCGTATGAAGGGGATGAATGGCAGGCGTTTCTGCGGCTGAATGACGAAAACCGGGCACCGTTTTCCGCGTTTCTCCGTCTGCCGGAAGCCGCCATTCTGTCGGTTTCACCGGAGCGCTTTCTGTGGCTGAAAGACGGCACCGCAGAAACCCGCCCGATTAAAGGCACCCGTCCGCGTCATCCCGCTGATCCGCAGGCCGACGAAGCAGAAAAACAGGCGCTGGCCGCGTCAGAGAAAGATCGCTCGGAAAACCTGATGATTGTGGATCTGATGCGCAATGATATCGGCCGGGTGGCACTTCCCGGCTCGGTCAGTGTGCCGTCGCTGTTTGCTGTTGAGCCGTTCCCGGCAGTCTGGCATCTGGTCAGCACCATCACCGCACAGTTACCGGCGGCATGCCGGGCAGCACAGTTACTGCGCGCCTGCTTCCCGGGCGGTTCGATTACCGGTGCGCCGAAAATCCGCGCGATGGAAATTATTGAAGAGCTCGAACCTGTCCGCCGCCACACCTATTGCGGCTCCGTCGGTTATATCAGCGCCTGTGGCACCATGGATACCAATATCGCGATCAGAACCCTGATTGCGGAAAATAATCACCTTTATTGCCGGGCAGGCGGCGGGATTGTCGCAGACAGCCGTGCCGCAGATGAATACCAGGAAACGTTCGATAAACTGGGCCGCATACTGACGGTACTGCCGGAGAAAATATTATGAGTCCGCTTGAGCGCTTTATTCCCCGGTTTCAGTTAACCCGCCCTTCCGAA