Homologs in group_1823

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13510 FBDBKF_13510 50.2 Morganella morganii S1 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
EHELCC_08585 EHELCC_08585 50.2 Morganella morganii S2 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
NLDBIP_08910 NLDBIP_08910 50.2 Morganella morganii S4 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
LHKJJB_05355 LHKJJB_05355 50.2 Morganella morganii S3 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
HKOGLL_05560 HKOGLL_05560 50.2 Morganella morganii S5 citB DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains
F4V73_RS03250 F4V73_RS03250 48.8 Morganella psychrotolerans - LuxR C-terminal-related transcriptional regulator

Distribution of the homologs in the orthogroup group_1823

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1823

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31802 5.62e-68 210 48 2 212 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P44845 2.73e-62 195 44 0 201 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P13800 2.72e-36 129 34 2 226 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
P55184 8.62e-35 125 33 3 207 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
O32197 2.29e-34 124 36 1 199 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
P54662 6.36e-33 121 35 2 219 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
O07528 9.27e-33 120 36 5 206 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P0AF31 2.65e-31 116 38 2 201 3 narL Nitrate/nitrite response regulator protein NarL Shigella flexneri
P0AF28 2.65e-31 116 38 2 201 1 narL Nitrate/nitrite response regulator protein NarL Escherichia coli (strain K12)
P0AF29 2.65e-31 116 38 2 201 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AF30 2.65e-31 116 38 2 201 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O157:H7
Q7A0I0 1.18e-28 109 32 1 201 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 1.18e-28 109 32 1 201 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 1.18e-28 109 32 1 201 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 1.18e-28 109 32 1 201 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 1.18e-28 109 32 1 201 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 1.18e-28 109 32 1 201 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q1M7A0 3.34e-28 108 31 2 195 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P94439 4.78e-28 108 33 3 212 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q6GE42 1.41e-27 107 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MRSA252)
Q2YZ42 1.41e-27 107 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain bovine RF122 / ET3-1)
P96686 1.41e-27 107 33 3 200 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q7A029 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q7A3U5 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
A5IVH2 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 3.23e-27 105 32 2 200 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
P0A4H2 1.41e-26 104 30 2 192 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 1.41e-26 104 30 2 192 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 1.41e-26 104 30 2 192 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P24908 1.89e-26 103 35 3 204 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4L8Q6 6.23e-26 102 31 3 200 3 nreC Oxygen regulatory protein NreC Staphylococcus haemolyticus (strain JCSC1435)
Q5HLK6 8.59e-26 102 30 3 201 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN75 1.14e-25 102 30 3 201 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q7WZY4 1.71e-24 99 31 3 200 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
O07019 2.95e-24 97 31 1 196 3 yvfU Uncharacterized transcriptional regulatory protein YvfU Bacillus subtilis (strain 168)
P9WMF9 8.48e-24 97 32 2 200 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 8.48e-24 97 32 2 200 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A8R3S7 1.3e-23 96 32 1 195 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
Q51373 1.53e-23 96 25 1 204 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P27667 2.55e-23 95 33 4 190 3 uhpA Transcriptional regulatory protein UhpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AGA9 8.38e-23 94 32 4 190 3 uhpA Transcriptional regulatory protein UhpA Shigella flexneri
P0AGA6 8.38e-23 94 32 4 190 1 uhpA Transcriptional regulatory protein UhpA Escherichia coli (strain K12)
P0AGA7 8.38e-23 94 32 4 190 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA8 8.38e-23 94 32 4 190 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O157:H7
P9WGM5 2.32e-22 93 29 1 195 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 2.32e-22 93 29 1 195 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5HEP0 2.33e-22 93 32 1 201 3 vraR Response regulator protein VraR Staphylococcus aureus (strain COL)
Q2FX09 2.33e-22 93 32 1 201 1 vraR Response regulator protein VraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8CNP9 5.55e-22 92 31 1 201 3 vraR Response regulator protein VraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN50 5.55e-22 92 31 1 201 3 vraR Response regulator protein VraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P26319 6.11e-22 92 28 4 201 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEL8 1.41e-21 91 29 3 198 3 fimZ Fimbriae Z protein Escherichia coli (strain K12)
P0AEL9 1.41e-21 91 29 3 198 3 fimZ Fimbriae Z protein Escherichia coli O157:H7
Q49YS9 5.04e-21 89 31 2 206 3 vraR Response regulator protein VraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L7J5 6.84e-21 89 31 1 201 3 vraR Response regulator protein VraR Staphylococcus haemolyticus (strain JCSC1435)
O34723 7.8e-21 89 30 3 194 1 desR Transcriptional regulatory protein DesR Bacillus subtilis (strain 168)
P0ACZ7 1.9e-20 88 27 5 193 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 1.9e-20 88 27 5 193 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 1.9e-20 88 27 5 193 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 1.9e-20 88 27 5 193 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
P95582 2.11e-20 88 25 1 204 3 gacA Response regulator GacA Pseudomonas viridiflava
Q52376 3.56e-20 87 25 1 204 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
P32967 7.83e-20 86 26 2 203 1 gacA Response regulator GacA Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q7CQM5 1.91e-19 85 32 1 194 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AED6 5.94e-19 84 24 1 205 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 5.94e-19 84 24 1 205 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P66797 6.46e-19 84 24 1 205 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 6.46e-19 84 24 1 205 3 uvrY Response regulator UvrY Escherichia coli O157:H7
P56644 2.6e-17 79 30 4 196 3 sgaR Probable transcriptional regulatory protein SgaR Hyphomicrobium methylovorum
A8R3T0 8.81e-15 73 31 4 207 3 agmR Glycerol metabolism activator Pseudomonas putida
P29369 2.31e-14 72 30 3 212 3 agmR Glycerol metabolism activator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8KR08 1.82e-13 69 34 1 148 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q3LWR6 2e-12 67 33 1 142 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 2e-12 67 33 1 142 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 2e-12 67 33 1 142 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P9WGN1 4.04e-12 66 35 2 116 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 4.04e-12 66 35 2 116 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P14204 4.06e-12 65 25 3 204 1 comA Transcriptional regulatory protein ComA Bacillus subtilis (strain 168)
B0R4K1 8.18e-12 63 31 1 101 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P26487 1.31e-11 64 27 6 198 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
O34903 2.06e-11 64 29 7 212 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P39663 6.58e-11 63 33 2 114 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P21866 7.69e-11 62 38 2 117 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q56127 1.18e-10 62 27 4 203 3 rcsB Transcriptional regulatory protein RcsB Salmonella typhi
P58663 2.01e-10 61 27 4 203 1 rcsB Transcriptional regulatory protein RcsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P69410 2.07e-10 61 27 4 203 3 rcsB Transcriptional regulatory protein RcsB Shigella flexneri
P0DMC8 2.07e-10 61 27 4 203 1 rcsB Transcriptional regulatory protein RcsB Escherichia coli
P0DMC7 2.07e-10 61 27 4 203 1 rcsB Transcriptional regulatory protein RcsB Escherichia coli (strain K12)
P69408 2.07e-10 61 27 4 203 3 rcsB Transcriptional regulatory protein RcsB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69409 2.07e-10 61 27 4 203 3 rcsB Transcriptional regulatory protein RcsB Escherichia coli O157:H7
P10958 3.96e-10 60 25 2 194 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
O85128 4.07e-10 61 34 1 96 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
P29904 4.15e-10 60 30 5 180 4 moxX Methanol utilization control regulatory protein MoxX Paracoccus denitrificans
P43501 4.79e-10 58 29 2 120 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P24072 6.06e-10 58 27 1 117 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q9HV32 7.83e-10 59 34 1 113 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q56312 8.26e-10 57 28 1 114 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1SMR4 8.3e-10 60 30 2 129 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A0QTK2 1.35e-09 59 33 2 101 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45189 1.42e-09 59 33 6 136 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96602 1.73e-09 58 21 4 197 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q0A9Z5 1.73e-09 60 31 1 101 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q15RF6 2.53e-09 59 31 1 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P35163 2.75e-09 58 32 2 101 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P9WGM3 3.03e-09 57 31 2 116 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 3.03e-09 57 31 2 116 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P39486 3.07e-09 58 22 0 117 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q82Z76 3.21e-09 58 29 2 117 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
Q3ADA6 3.73e-09 58 32 1 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P23221 4.13e-09 57 27 6 194 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8Z5C1 1.11e-08 56 34 3 106 3 btsR Transcriptional regulatory protein BtsR Salmonella typhi
O54294 1.16e-08 56 34 2 102 1 csgD Probable csgAB operon transcriptional regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9I4F9 1.31e-08 56 31 1 109 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2YC79 1.33e-08 57 25 2 135 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P45709 1.51e-08 54 26 1 104 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
A0R3I8 1.86e-08 56 34 2 114 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0HWY6 2.25e-08 56 31 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
O69730 2.35e-08 55 28 1 107 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
L7N689 2.74e-08 55 29 1 113 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A1TEL7 2.78e-08 55 32 1 113 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q0HKN5 2.81e-08 56 31 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
Q8ZNN2 2.92e-08 55 33 3 106 3 btsR Transcriptional regulatory protein BtsR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q93CB8 2.99e-08 55 32 2 101 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 3.46e-08 55 32 2 101 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 3.46e-08 55 32 2 101 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 3.46e-08 55 32 2 101 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2FQU2 3.49e-08 55 25 2 138 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q9CCJ2 3.6e-08 55 32 2 101 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P52106 3.71e-08 55 33 2 102 1 csgD CsgBAC operon transcriptional regulatory protein Escherichia coli (strain K12)
Q8D4U6 4.55e-08 55 31 3 109 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
P59640 4.94e-08 55 31 4 119 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri
A1KHB7 5.2e-08 54 28 6 191 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 5.2e-08 54 28 6 191 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2W2W9 5.24e-08 55 33 2 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5E3S1 5.58e-08 55 30 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P0A4H8 6.06e-08 54 26 4 183 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 6.06e-08 54 26 4 183 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0AFT5 6.24e-08 54 31 4 119 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 6.24e-08 54 31 4 119 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 6.24e-08 54 31 4 119 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 6.24e-08 54 31 4 119 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
P9WGM9 6.71e-08 54 28 6 191 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 6.71e-08 54 28 6 191 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 6.71e-08 54 28 6 191 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q1B3X8 7.18e-08 54 32 1 113 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 7.18e-08 54 32 1 113 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 7.18e-08 54 32 1 113 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P52942 8.01e-08 52 28 2 116 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
A0PWB4 9.23e-08 53 32 1 116 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
P45606 9.54e-08 53 27 7 209 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q10WZ6 9.89e-08 54 30 2 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q31HL9 1.03e-07 54 28 1 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P0AFJ5 1.12e-07 53 27 7 209 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.12e-07 53 27 7 209 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
Q0AYL3 1.36e-07 54 21 2 147 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P58664 1.54e-07 53 24 2 197 4 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli O157:H7
P45607 1.66e-07 53 27 8 207 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P0A4H5 1.81e-07 51 26 1 115 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 1.81e-07 51 26 1 115 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q485K0 1.87e-07 53 31 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q1D359 1.89e-07 53 30 1 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q8ECD7 2.04e-07 53 30 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q742C1 2.06e-07 53 32 1 113 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 2.06e-07 53 32 1 113 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q5QZQ3 2.32e-07 53 26 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8DB67 2.49e-07 53 25 5 193 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
Q8EQQ3 2.6e-07 52 24 1 129 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q51455 2.68e-07 50 31 2 103 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9K998 2.83e-07 52 20 0 116 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9CD68 2.84e-07 52 32 1 113 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q7MIQ5 3e-07 53 25 5 193 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q2KCH8 3.63e-07 53 29 1 96 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0VKZ4 3.71e-07 53 40 0 61 2 alkS HTH-type transcriptional regulator AlkS Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q4L8V4 3.72e-07 52 27 1 113 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q3IDZ3 6.36e-07 52 30 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
P37478 6.44e-07 51 24 6 214 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q2RZD2 7.49e-07 52 26 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
P23620 7.7e-07 51 28 7 213 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q39QJ2 8.59e-07 52 30 1 102 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q87MK5 8.74e-07 52 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1MLG8 8.85e-07 52 25 3 148 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
O87940 9.38e-07 51 25 2 190 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
Q6LTM2 1.09e-06 51 27 1 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
P45605 1.31e-06 50 26 8 209 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q9KU36 1.33e-06 50 27 4 154 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q167K9 1.4e-06 51 30 1 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q4L6C6 1.4e-06 50 29 2 121 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P26275 1.41e-06 50 28 2 117 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7D9K0 1.44e-06 50 29 2 139 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 1.44e-06 50 29 2 139 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q2ILG8 1.67e-06 51 28 5 166 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P62638 1.68e-06 51 32 3 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q88EW5 1.74e-06 50 34 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O87125 1.97e-06 50 34 3 107 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1XDE4 2.13e-06 50 26 4 196 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q48GG6 2.16e-06 50 32 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
O52262 2.23e-06 50 34 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
Q884V3 2.4e-06 50 31 1 108 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8TLG9 2.61e-06 50 24 1 101 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q4ZQV7 2.62e-06 50 32 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
P62647 2.68e-06 50 28 1 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q085K9 3.06e-06 50 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q55890 3.12e-06 49 27 7 222 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q99U73 3.34e-06 49 26 4 199 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q21IQ9 3.71e-06 50 29 2 120 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P13792 3.94e-06 49 30 1 101 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q7A0U4 4e-06 49 31 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 4e-06 49 31 2 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 4e-06 49 31 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 4e-06 49 31 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 4e-06 49 31 2 104 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 4e-06 49 31 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 4e-06 49 31 2 104 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 4e-06 49 31 2 104 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P51586 4.42e-06 47 31 2 107 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q9KQD5 4.43e-06 47 29 2 106 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 4.43e-06 47 29 2 106 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P38684 4.48e-06 49 30 3 119 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P32040 4.52e-06 49 25 6 225 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P26408 4.77e-06 49 31 3 118 1 hupR1 Hydrogenase transcriptional regulatory protein HupR1 Rhodobacter capsulatus
Q1CZL0 4.93e-06 49 31 2 97 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Myxococcus xanthus (strain DK1622)
Q12PJ3 5.01e-06 49 29 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q3KFZ6 5.05e-06 49 33 3 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
Q4KG36 5.25e-06 49 33 3 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P58357 5.27e-06 48 30 3 119 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P62637 5.94e-06 49 26 1 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P15940 6.2e-06 48 25 2 189 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1IRH0 7.51e-06 49 30 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
Q04942 7.85e-06 48 27 3 109 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q49XM7 8.67e-06 48 28 2 121 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9KL96 9.93e-06 48 27 2 105 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5JF95 1.01e-05 48 29 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P11470 1.1e-05 45 44 1 63 1 gerE Spore germination protein GerE Bacillus subtilis (strain 168)
Q9KT84 1.16e-05 48 26 0 86 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2LR65 1.18e-05 48 31 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
Q8Q009 1.3e-05 48 23 1 101 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P0A4I0 1.3e-05 47 33 0 68 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.3e-05 47 33 0 68 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P0C001 1.3e-05 47 28 2 120 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.3e-05 47 28 2 120 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.3e-05 47 28 2 120 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.3e-05 47 28 2 120 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.3e-05 47 28 2 120 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.3e-05 47 28 2 120 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.3e-05 47 28 2 120 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.3e-05 47 28 2 120 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
O87717 1.36e-05 48 25 3 154 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P17051 1.46e-05 48 38 1 62 2 alkS HTH-type transcriptional regulator AlkS Pseudomonas oleovorans
Q7MM78 1.47e-05 48 26 0 86 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 1.47e-05 48 26 0 86 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P06628 1.55e-05 46 23 2 121 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q8D0P1 1.68e-05 46 28 2 103 3 cheY Chemotaxis protein CheY Yersinia pestis
P0C5S5 1.71e-05 48 25 0 86 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.71e-05 48 25 0 86 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P0CL17 1.73e-05 47 28 5 156 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 1.73e-05 47 28 5 156 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
B8H358 1.79e-05 47 26 2 119 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.79e-05 47 26 2 119 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q93P00 1.8e-05 46 28 2 103 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q87MX7 1.84e-05 48 25 0 86 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P72781 1.88e-05 47 24 5 223 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q30RX5 2.19e-05 47 30 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q57QC3 2.24e-05 47 26 4 154 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q9KQD8 2.24e-05 47 27 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q46791 2.28e-05 46 27 1 131 1 ygeK Uncharacterized response regulatory protein YgeK Escherichia coli (strain K12)
Q24T61 2.35e-05 47 27 1 97 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
Q3YWK7 2.44e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Shigella sonnei (strain Ss046)
Q31VL4 2.47e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Shigella boydii serotype 4 (strain Sb227)
B7UKC3 2.47e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P23836 2.52e-05 47 25 1 109 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
B7N1J6 2.54e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O81 (strain ED1a)
B1LI79 2.56e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli (strain SMS-3-5 / SECEC)
Q0TC49 2.56e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NMI3 2.56e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B6I2Y2 2.58e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli (strain SE11)
B7NE23 2.58e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8CXX5 2.58e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7M2H9 2.58e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O8 (strain IAI1)
B5YTW9 2.58e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X701 2.58e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O157:H7
B7L4U8 2.58e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli (strain 55989 / EAEC)
Q1R5L6 2.61e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli (strain UTI89 / UPEC)
A1AGU2 2.61e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O1:K1 / APEC
B7MDP4 2.61e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0AWZ8 2.62e-05 47 25 1 102 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A7ZSU8 2.63e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Escherichia coli O139:H28 (strain E24377A / ETEC)
Q9I0I1 2.64e-05 47 28 2 114 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0SZP7 2.68e-05 47 47 0 53 3 malT HTH-type transcriptional regulator MalT Shigella flexneri serotype 5b (strain 8401)
Q2SBX9 2.76e-05 47 28 1 105 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
Q83RR0 2.93e-05 47 25 1 109 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 2.93e-05 47 25 1 109 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P94514 3.01e-05 47 26 2 116 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
Q8RAZ3 3.04e-05 47 28 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8Z7H2 3.12e-05 46 26 4 154 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P0DM78 3.28e-05 46 26 4 154 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 3.28e-05 46 26 4 154 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 3.28e-05 46 26 4 154 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 3.28e-05 46 26 4 154 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 3.28e-05 46 26 4 154 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7N5N6 3.29e-05 47 43 0 53 3 malT HTH-type transcriptional regulator MalT Vibrio campbellii (strain ATCC BAA-1116)
Q87FQ5 3.48e-05 47 43 0 53 3 malT HTH-type transcriptional regulator MalT Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MG94 3.61e-05 47 43 0 53 3 malT HTH-type transcriptional regulator MalT Vibrio vulnificus (strain YJ016)
Q8D4P3 3.61e-05 47 43 0 53 3 malT HTH-type transcriptional regulator MalT Vibrio vulnificus (strain CMCP6)
Q50136 3.66e-05 46 29 2 141 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q2SPQ1 4.06e-05 47 29 1 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
Q8EDD7 4.09e-05 46 29 2 117 3 SO_2823 Uncharacterized response regulatory protein SO_2823 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q1IQS9 4.27e-05 47 23 1 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q8ZBV2 4.55e-05 46 31 2 103 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
Q9KNF3 4.59e-05 47 43 0 53 3 malT HTH-type transcriptional regulator MalT Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2SFK0 4.76e-05 46 31 3 98 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q9WYN9 4.86e-05 46 26 1 102 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B8GZM2 5.08e-05 46 29 3 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 5.08e-05 46 29 3 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q3ADG9 5.26e-05 46 23 1 122 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9HWA4 5.33e-05 46 30 3 121 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q814J1 5.71e-05 46 27 2 103 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q52883 5.79e-05 46 27 1 96 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q31S42 5.9e-05 46 26 7 222 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O05251 6.79e-05 45 23 3 199 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q9WY30 7.09e-05 46 26 3 120 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q12YX1 7.33e-05 46 23 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
P0C5S3 8.77e-05 45 28 3 142 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
Q8Z227 8.94e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella typhi
B5R7J9 9.19e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8ZLI3 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TY75 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella schwarzengrund (strain CVM19633)
B5BHH3 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella paratyphi A (strain AKU_12601)
A9MTT7 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PM00 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SVL9 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella newport (strain SL254)
B4TKU2 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella heidelberg (strain SL476)
B5R375 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella enteritidis PT4 (strain P125109)
B5F8N2 9.28e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella agona (strain SL483)
Q9KA55 9.36e-05 45 25 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B5FKD6 9.46e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella dublin (strain CT_02021853)
Q57IV9 9.63e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella choleraesuis (strain SC-B67)
A4WFK6 9.63e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Enterobacter sp. (strain 638)
Q4A010 9.65e-05 45 26 1 103 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A9MMA9 9.72e-05 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AQX2 0.000102 46 46 0 50 3 malT HTH-type transcriptional regulator MalT Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2FWH6 0.000125 45 30 3 118 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q88AQ2 0.000144 45 28 2 114 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B7LSC1 0.000145 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P06993 0.000145 45 46 0 50 1 malT HTH-type transcriptional regulator MalT Escherichia coli (strain K12)
B1IP47 0.000145 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5M7 0.000145 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Escherichia coli O9:H4 (strain HS)
B1X764 0.000145 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Escherichia coli (strain K12 / DH10B)
C4ZVX0 0.000145 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Escherichia coli (strain K12 / MC4100 / BW2952)
B1JHZ0 0.000152 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664J3 0.000152 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGR4 0.000152 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Yersinia pestis (strain Pestoides F)
Q8ZJI2 0.000152 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Yersinia pestis
B2K5W2 0.000152 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2L4 0.000152 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNW4 0.000152 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6UEL7 0.000155 44 28 3 142 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
A8GKU0 0.000159 45 45 0 53 3 malT HTH-type transcriptional regulator MalT Serratia proteamaculans (strain 568)
A6TF41 0.00016 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTR7 0.000163 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Klebsiella pneumoniae (strain 342)
Q8NML3 0.000165 45 43 0 53 2 ramA HTH-type transcriptional activator RamA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q88RJ6 0.000187 45 28 2 114 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P9WGM1 0.000192 44 28 2 141 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 0.000192 44 28 2 141 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 0.000192 44 28 2 141 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P94413 0.000193 44 26 6 165 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P42421 0.000201 44 26 8 211 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q81JL3 0.000202 44 26 2 103 3 lytT Sensory transduction protein LytT Bacillus anthracis
Q7N976 0.000204 45 43 0 53 3 malT HTH-type transcriptional regulator MalT Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P59969 0.000215 45 42 0 50 4 BQ2027_MB0914C Putative HTH-type transcriptional regulator Mb0914c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMG0 0.000215 45 42 0 50 4 MT0914 Putative HTH-type transcriptional regulator MT0914 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A7ME76 0.000223 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Cronobacter sakazakii (strain ATCC BAA-894)
P30843 0.000225 44 28 2 120 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
A1JSF2 0.000228 45 46 0 50 3 malT HTH-type transcriptional regulator MalT Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
O58192 0.000229 44 24 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8DPL7 0.000231 44 31 3 102 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 0.000231 44 31 3 102 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 0.000231 44 31 3 102 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P44918 0.000233 44 24 3 145 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6WZ81 0.000254 44 25 1 109 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q4KHL8 0.000256 44 31 1 99 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8FZ93 0.000259 44 25 1 109 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 0.000259 44 25 1 109 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 0.000259 44 25 1 109 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 0.000259 44 25 1 109 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 0.000259 44 25 1 109 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 0.000259 44 25 1 109 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 0.000259 44 25 1 109 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 0.000259 44 25 1 109 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q02540 0.000262 43 32 0 82 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q39T95 0.000277 44 25 1 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P37640 0.000291 43 36 0 58 1 yhjB Putative HTH-type transcriptional regulator YhjB Escherichia coli (strain K12)
Q8D4X6 0.000292 44 24 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
P9WMG1 0.000294 44 42 0 50 1 Rv0890c Putative HTH-type transcriptional regulator Rv0890c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P23747 0.000297 44 27 1 114 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7CQM8 0.000304 43 28 4 146 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P76340 0.000307 43 31 5 113 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q4LAJ9 0.000308 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q3IRR4 0.000311 44 27 2 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q7MBQ5 0.000318 44 24 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q39S45 0.000328 44 27 1 97 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9M8Y4 0.000329 42 29 4 106 2 ARR22 Two-component response regulator ARR22 Arabidopsis thaliana
Q8DN02 0.000342 43 23 6 204 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 0.000342 43 23 6 204 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P36556 0.000379 43 29 1 113 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47456 0.00038 43 31 0 82 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
P0AE69 0.000398 42 26 2 103 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 0.000398 42 26 2 103 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 0.000398 42 26 2 103 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q6GK93 0.000414 43 25 2 104 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q2YV56 0.000422 43 25 2 104 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6D6I7 0.000431 43 22 6 202 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q47I43 0.000431 43 28 1 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
Q2NB98 0.000436 43 36 1 66 1 ELI_04755 Light-activated DNA-binding protein EL222 Erythrobacter litoralis (strain HTCC2594)
Q9F868 0.000446 43 29 2 102 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8FGP6 0.000456 42 26 2 103 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O82868 0.000463 43 28 6 140 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q8NYJ9 0.000481 43 25 2 104 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 0.000481 43 25 2 104 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 0.000481 43 25 2 104 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 0.000481 43 25 2 104 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 0.000481 43 25 2 104 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q8EF61 0.000539 43 25 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8X738 0.000541 43 24 1 109 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q9L4M7 0.000545 43 34 1 67 3 alkS HTH-type transcriptional regulator AlkS Pseudomonas putida
O34534 0.000621 43 19 4 207 1 citT Transcriptional regulatory protein CitT Bacillus subtilis (strain 168)
Q65JK6 0.000625 43 25 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q01473 0.000627 43 27 5 158 3 rcaC Protein RcaC Microchaete diplosiphon
Q8CQK0 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A216 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 0.00063 43 25 2 102 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 0.00063 43 25 2 102 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 0.00063 43 25 2 102 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 0.00063 43 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9UYF3 0.000639 43 23 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q4UU97 0.000686 43 29 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8P9J7 0.000686 43 29 1 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UU85 0.000716 43 25 6 204 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P52941 0.000723 42 21 1 128 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q5GYV8 0.000788 43 29 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 0.000788 43 29 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q0HVI0 0.000833 43 25 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
Q4A160 0.000843 42 25 2 102 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q0HIF6 0.000865 43 26 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
Q44006 0.001 42 27 2 116 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3BUA2 0.001 42 29 1 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLB4 0.001 42 29 1 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07560
Feature type CDS
Gene -
Product response regulator
Location 1652173 - 1652796 (strand: 1)
Length 624 (nucleotides) / 207 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1823
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00196 Bacterial regulatory proteins, luxR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2197 Signal transduction mechanisms (T)
Transcription (K)		 TK DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains

Protein Sequence

MPSYSIMIVDDHPIMRYGLRLLLEQDKEFIVVSESGNAQEAITTAKQLNPDLIMMDLHLQGRSGIDIIRSLRRCGLTSYVLVLSISDSRNDVYAALDAGANGYLLKECELDMLLLSLRKAVVGRPVYSEKVWQYIQLRQNYSDPLSALTKRELDVLQEVAVGMKNKQIAENLFISEETVKVHIRNILKKLQVTSRLAASLILIKHQH

Flanking regions ( +/- flanking 50bp)

TTTTCTGCTGTTGAAAAGATTACGCATATTATTTTTTAGGGAGAGGGGTTATGCCTAGCTACTCAATTATGATAGTGGATGATCACCCTATCATGAGATATGGATTACGGCTATTGTTAGAGCAAGACAAGGAATTTATTGTAGTAAGCGAAAGTGGCAATGCTCAAGAAGCAATCACCACAGCAAAACAGTTAAATCCTGATCTTATTATGATGGATTTACACCTTCAAGGACGCTCTGGTATTGATATTATTCGTTCTCTGCGTCGCTGTGGTTTAACATCTTATGTATTGGTTTTATCAATTTCAGATTCTCGCAATGATGTGTATGCTGCATTAGATGCTGGTGCTAACGGTTATTTATTGAAAGAGTGTGAACTTGATATGTTGCTACTCAGTTTACGTAAAGCGGTGGTTGGGCGCCCCGTTTACAGTGAAAAAGTTTGGCAATATATCCAATTAAGACAAAACTATTCTGATCCGCTATCTGCGTTAACAAAAAGAGAACTTGATGTCCTTCAAGAAGTGGCGGTGGGAATGAAAAATAAACAGATTGCCGAAAATCTGTTTATCTCAGAAGAAACCGTCAAAGTACATATTCGTAATATCTTAAAGAAACTACAAGTGACATCACGTTTAGCGGCGAGCCTTATCTTAATTAAGCATCAGCACTAAACGAATTTACCCCGACATTAAGTCGGGGTAATTAAGTTCTTAAGGAAGCC