Homologs in group_2860

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10950 FBDBKF_10950 72.1 Morganella morganii S1 modB ABC-type sulfate transport system, permease component
EHELCC_05275 EHELCC_05275 72.1 Morganella morganii S2 modB ABC-type sulfate transport system, permease component
NLDBIP_05595 NLDBIP_05595 72.1 Morganella morganii S4 modB ABC-type sulfate transport system, permease component
LHKJJB_02475 LHKJJB_02475 72.1 Morganella morganii S3 modB ABC-type sulfate transport system, permease component
HKOGLL_15855 HKOGLL_15855 72.1 Morganella morganii S5 modB ABC-type sulfate transport system, permease component

Distribution of the homologs in the orthogroup group_2860

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2860

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57380 1.53e-35 126 53 0 113 5 HI_1475 Putative uncharacterized protein HI_1475 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D4GQ17 2.83e-29 114 37 4 231 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P45322 1.72e-23 98 34 2 178 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O32209 2.72e-23 97 31 2 220 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
O30143 7.24e-23 97 29 3 222 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P18795 9.42e-23 97 30 3 218 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
A2CI71 1.17e-22 97 27 3 259 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
P56343 3.86e-22 95 27 1 208 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
P41032 4.24e-22 95 28 1 229 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P16701 1.49e-21 94 27 1 229 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
Q9TJR4 1.85e-21 93 27 4 239 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
Q9TKU8 2.68e-21 93 28 3 259 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q9MUL9 2.25e-20 90 25 2 254 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
P37731 2.35e-20 89 28 2 217 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
Q32RF7 7.86e-20 89 25 1 247 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
P9WG13 9.62e-20 89 35 2 220 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 9.62e-20 89 35 2 220 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 9.62e-20 89 35 2 220 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P26246 1.12e-19 89 25 1 206 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
P74547 2.12e-18 85 29 1 195 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8U4K4 1.33e-17 82 32 3 195 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O57893 9.08e-17 80 26 3 242 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8RVC7 1.78e-16 81 26 4 254 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
Q0P886 2.63e-16 79 30 3 209 1 tupB Tungstate uptake system permease protein TupB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q58763 4.38e-16 78 28 5 216 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9V2C1 4.78e-16 78 27 2 204 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
Q2EEX6 7.92e-16 78 28 2 172 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P27370 1.35e-15 77 28 3 209 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P0AEB0 3.73e-15 76 26 4 265 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 3.73e-15 76 26 4 265 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q08382 7.59e-15 74 27 2 192 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
P0AF01 8.11e-15 74 33 8 231 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 8.11e-15 74 33 8 231 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
Q5JEB3 3.37e-14 73 30 1 160 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q85AI0 6.64e-14 73 24 1 205 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
Q6QJE2 1.52e-12 70 28 1 177 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
P27367 2.28e-12 68 25 2 211 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q01895 3.99e-12 68 25 2 198 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0AFK5 6.22e-12 67 27 2 203 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 6.22e-12 67 27 2 203 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
P0CL49 3.28e-11 65 26 2 203 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 3.28e-11 65 26 2 203 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 3.28e-11 65 26 2 203 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
Q57SD7 5.75e-11 64 26 5 238 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
P96064 5.86e-11 64 26 5 238 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 6.11e-11 64 26 5 238 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8W9 4.97e-10 62 25 5 238 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
Q8Z8X0 2.09e-08 57 29 7 214 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhi
Q5PFQ5 2.38e-08 57 29 7 214 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P31135 3.57e-08 56 25 3 225 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
Q93KD5 3.64e-08 56 25 3 181 1 tupB Tungstate uptake system permease protein TupB Peptoclostridium acidaminophilum
P96065 1.61e-07 54 29 7 214 2 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57SD8 1.85e-07 54 29 7 214 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella choleraesuis (strain SC-B67)
Q57341 1.7e-06 52 25 5 224 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44123 6.9e-06 50 27 3 168 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q8FYV0 8.42e-06 50 28 5 200 3 thiP Thiamine transport system permease protein ThiP Brucella suis biovar 1 (strain 1330)
Q57BC3 1.05e-05 49 28 4 190 3 thiP Thiamine transport system permease protein ThiP Brucella abortus biovar 1 (strain 9-941)
Q2YLW7 1.05e-05 49 28 4 190 3 thiP Thiamine transport system permease protein ThiP Brucella abortus (strain 2308)
P0AFK6 4.43e-05 47 21 2 207 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli (strain K12)
P0AFK7 4.43e-05 47 21 2 207 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFK8 4.43e-05 47 21 2 207 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O157:H7
Q83RR7 5.38e-05 47 21 2 207 3 potC Spermidine/putrescine transport system permease protein PotC Shigella flexneri
P77156 0.00012 46 27 6 212 1 ydcU Inner membrane ABC transporter permease protein YdcU Escherichia coli (strain K12)
Q8YJ03 0.000133 46 27 4 190 3 thiP Thiamine transport system permease protein ThiP Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P55452 0.000156 46 26 6 182 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
D4GSY8 0.000337 44 26 6 216 3 HVO_1887 Probable anion ABC transporter permease protein HVO_1887 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P47290 0.000438 44 19 5 227 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q45461 0.000536 43 24 3 148 2 opuBB Choline transport system permease protein OpuBB Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07485
Feature type CDS
Gene -
Product ABC transporter permease
Location 1631657 - 1632433 (strand: -1)
Length 777 (nucleotides) / 258 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2860
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0555 Inorganic ion transport and metabolism (P) P ABC-type sulfate transport system, permease component

Protein Sequence

MYRWALIPLLLLLFLILGSLIALICQLSYHELTMVITDAEFHFAVLMSLSTALTSLCLAVLLAVPAAWVMARSSFKGQRFIDALLDLPLVTPPLVIGIGLLLLLGHQGPLTGVFPQLSRALFSPLGIIIAQTYVASAIIMRNSLAAFKAIDPAYIQTAQNLGLTPTKTLILVEIPLCWSVLISGCIVAFSRALGEFGATLMLAGATRLKTETLPMAIYLNIASGDFSLAIGCALVLIAIAITLLFALHRLQRDRKLAC

Flanking regions ( +/- flanking 50bp)

TTTTCATTTTTACAATAAATGTCATTAGTAGATTAAGAGAAGGCTTCACTGTGTATCGTTGGGCACTAATACCACTTTTATTATTATTATTTTTGATATTGGGATCACTTATTGCATTAATTTGCCAACTCTCTTATCACGAACTCACCATGGTTATTACTGATGCTGAATTTCATTTTGCCGTATTGATGTCACTGAGCACCGCGTTAACATCATTGTGTTTAGCCGTGCTCTTAGCTGTACCTGCAGCTTGGGTGATGGCAAGATCGTCATTTAAAGGACAGCGTTTTATTGATGCGTTACTCGATTTACCCTTAGTCACGCCTCCTTTGGTAATAGGTATTGGATTATTATTATTGTTAGGTCATCAAGGGCCTTTAACAGGGGTTTTCCCTCAATTATCTCGCGCCCTTTTTTCTCCCTTGGGGATTATTATTGCTCAAACATATGTGGCAAGTGCAATCATTATGCGTAATAGCCTTGCGGCGTTTAAAGCCATTGATCCTGCTTATATTCAAACCGCACAGAATTTAGGATTAACACCAACAAAAACGCTTATTTTGGTTGAGATCCCACTTTGTTGGTCTGTATTAATCAGTGGTTGTATTGTGGCTTTTTCTCGAGCATTAGGGGAGTTTGGGGCAACATTAATGTTGGCAGGGGCCACACGATTAAAAACAGAAACCTTACCAATGGCAATCTATTTAAATATAGCGAGTGGTGATTTCTCGCTTGCGATAGGTTGCGCTTTAGTACTGATAGCAATTGCAATTACTCTATTGTTTGCTTTACACCGTTTACAGCGTGATAGGAAATTAGCATGTTAACCATTCACTCGTTAACTACCGGTATTTTAACCGAGGTTTCATTACACCTA