Homologs in group_2881

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10950 FBDBKF_10950 100.0 Morganella morganii S1 modB ABC-type sulfate transport system, permease component
EHELCC_05275 EHELCC_05275 100.0 Morganella morganii S2 modB ABC-type sulfate transport system, permease component
LHKJJB_02475 LHKJJB_02475 100.0 Morganella morganii S3 modB ABC-type sulfate transport system, permease component
HKOGLL_15855 HKOGLL_15855 100.0 Morganella morganii S5 modB ABC-type sulfate transport system, permease component
PMI_RS07485 PMI_RS07485 72.1 Proteus mirabilis HI4320 - ABC transporter permease

Distribution of the homologs in the orthogroup group_2881

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2881

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57380 1.81e-35 125 54 0 112 5 HI_1475 Putative uncharacterized protein HI_1475 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P18795 6.82e-28 111 35 4 216 3 nifC Probable transport system permease protein NifC Clostridium pasteurianum
D4GQ17 4.92e-27 108 36 2 233 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O32209 9.78e-26 103 34 5 231 3 yvgM Putative molybdenum transport system permease protein YvgM Bacillus subtilis (strain 168)
O30143 1e-24 102 31 3 212 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A2CI71 1.29e-23 99 27 1 219 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
Q9MUL9 2.64e-22 95 25 2 236 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
P9WG13 1.93e-21 93 36 2 226 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG12 1.93e-21 93 36 2 226 3 modB Molybdenum transport system permease protein ModB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A625 1.93e-21 93 36 2 226 3 modB Molybdenum transport system permease protein ModB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P45322 6.31e-21 91 30 2 180 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9TKU8 1.08e-20 92 28 3 234 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q32RF7 3.43e-20 90 28 2 223 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
Q9TJR4 1.61e-19 88 29 4 209 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
P16701 3.53e-19 87 25 2 236 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
P56343 6.12e-19 86 28 4 221 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
P26246 7.8e-19 87 27 1 186 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
P41032 1.96e-18 85 25 1 231 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEB0 2.81e-18 85 27 4 233 1 cysW Sulfate transport system permease protein CysW Escherichia coli (strain K12)
P0AEB1 2.81e-18 85 27 4 233 3 cysW Sulfate transport system permease protein CysW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2EEX6 7.15e-18 84 29 3 180 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P0AF01 7.77e-18 83 32 4 230 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 7.77e-18 83 32 4 230 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
P37731 9.5e-18 82 27 1 211 3 modB Molybdenum transport system permease protein ModB Azotobacter vinelandii
Q5JEB3 3.64e-17 81 30 1 173 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P74547 3.65e-17 82 29 1 224 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O57893 4.22e-17 81 28 2 211 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8RVC7 9.46e-17 82 27 1 217 1 SULP1 Sulfate permease 1, chloroplastic Chlamydomonas reinhardtii
Q9V2C1 1.05e-16 80 31 1 173 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
P27367 2.03e-16 80 26 1 224 2 cysT Sulfate transport system permease protein CysT Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8U4K4 9.16e-16 77 30 1 172 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q01895 1.82e-15 77 28 3 201 2 cysT Sulfate transport system permease protein CysT Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q08382 2.49e-15 76 26 2 206 3 modB Molybdenum transport system permease protein ModB Rhodobacter capsulatus
Q58763 1.21e-14 74 27 6 226 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q85AI0 1.29e-14 75 24 1 231 2 cysT Probable sulfate transport system permease protein cysT Anthoceros angustus
P27370 8.38e-14 72 26 1 223 2 cysW Sulfate transport system permease protein CysW Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q0P886 1.06e-13 72 28 3 209 1 tupB Tungstate uptake system permease protein TupB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6QJE2 1.06e-13 73 30 1 177 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
Q57341 3.6e-08 57 25 7 227 3 fbpB1 Putative ferric transport system permease protein FbpB 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31135 4.68e-08 56 24 2 226 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
P96064 1.36e-07 55 26 4 225 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 1.49e-07 54 26 4 225 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0AFK5 2.45e-07 54 24 2 223 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 2.45e-07 54 24 2 223 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
Q57SD7 3.56e-07 53 25 4 225 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
P0CL49 6.6e-07 52 25 4 225 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 6.6e-07 52 25 4 225 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 6.6e-07 52 25 4 225 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
Q8Z8W9 9.93e-07 52 25 4 225 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
Q44123 2.14e-06 52 26 5 183 3 fbpB Ferric transport system permease protein FbpB Actinobacillus pleuropneumoniae
Q8Z8X0 1.1e-05 49 26 5 212 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhi
Q5PFQ5 1.26e-05 48 26 5 212 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8FYV0 2.13e-05 48 27 4 197 3 thiP Thiamine transport system permease protein ThiP Brucella suis biovar 1 (strain 1330)
Q8ZRV1 4.06e-05 48 24 4 247 1 thiP Thiamine transport system permease protein ThiP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55452 4.3e-05 48 24 4 202 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55452 0.000859 43 26 6 216 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P96065 5.19e-05 47 26 5 212 2 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57SD8 9.03e-05 46 26 5 211 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella choleraesuis (strain SC-B67)
Q57BC3 0.000126 46 27 4 197 3 thiP Thiamine transport system permease protein ThiP Brucella abortus biovar 1 (strain 9-941)
Q2YLW7 0.000126 46 27 4 197 3 thiP Thiamine transport system permease protein ThiP Brucella abortus (strain 2308)
D4GSY8 0.000233 45 29 6 220 3 HVO_1887 Probable anion ABC transporter permease protein HVO_1887 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P0AFL1 0.00079 43 26 4 228 1 potI Putrescine transport system permease protein PotI Escherichia coli (strain K12)
P0AFL2 0.00079 43 26 4 228 3 potI Putrescine transport system permease protein PotI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_05595
Feature type CDS
Gene modB
Product ABC-type sulfate transport system, permease component
Location 84240 - 85028 (strand: -1)
Length 789 (nucleotides) / 262 (amino acids)
In genomic island -

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2881
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0555 Inorganic ion transport and metabolism (P) P ABC-type sulfate transport system, permease component

Protein Sequence

MYPVMKWALVPLLLLLCLITGSLLALLFQVTPALLTQLITDPEFHFAVLMSLATSLTSLVLAFLIAVPAAWVMVRGDFPGKRVADALFDIPLVTPPLVIGIGLLLLLGSQGPLAGIFPQLGRWLFSPVGVIIAQTYVASAVLYRSAQGAFASVDPAYVRTAMNLGLTPGKTLLLAEIPLCLQGLLSGGILAYSRALGEFGATLMLAGATRFKTETLPMAIYLNIASGDFSLALGCALILMALAIVLLVALHRLKRQPSHAAR

Flanking regions ( +/- flanking 50bp)

GGTTTTCTGCCGGTCAGACCGGCTGATGCACACTGATTCCGGTATTACCGATGTATCCGGTGATGAAATGGGCGCTGGTGCCCCTGTTACTGTTGTTGTGTCTGATTACCGGGTCTCTGCTGGCGTTACTGTTTCAGGTAACGCCGGCGTTGCTGACTCAGCTGATTACTGACCCTGAATTTCATTTTGCGGTGCTGATGTCGCTGGCAACCTCACTGACATCGCTGGTACTGGCATTTCTGATTGCCGTACCGGCCGCCTGGGTGATGGTGCGGGGGGATTTCCCCGGCAAGCGGGTGGCGGATGCGCTGTTTGATATCCCGCTGGTCACGCCGCCGCTGGTGATTGGTATCGGGCTGTTACTGCTGCTGGGCAGTCAGGGCCCGCTGGCCGGAATTTTCCCGCAGTTGGGGCGCTGGCTGTTTTCCCCGGTGGGTGTGATTATCGCCCAGACCTATGTCGCGTCAGCGGTTCTGTACCGTTCGGCGCAGGGGGCGTTTGCCTCGGTGGATCCGGCATATGTCCGCACGGCAATGAATCTCGGGCTGACCCCCGGAAAAACCCTGCTGCTTGCGGAAATTCCGTTGTGTCTGCAGGGATTGCTGAGCGGCGGGATCCTCGCCTACTCCCGGGCGCTGGGGGAGTTCGGTGCCACACTGATGCTGGCCGGTGCCACCCGCTTTAAAACCGAAACCCTGCCAATGGCAATTTATCTTAATATTGCCAGCGGTGATTTTTCACTCGCGCTCGGCTGCGCGCTGATCCTGATGGCACTGGCGATTGTTTTGCTGGTCGCATTGCACCGGCTGAAAAGGCAACCTTCACATGCTGCACGTTGAACATCTGAGTGCGGGGATCCTGCAGGATCTCTCGCTGACACTGCCGCGCG