Homologs in group_1033

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05320 FBDBKF_05320 70.4 Morganella morganii S1 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
EHELCC_12270 EHELCC_12270 70.4 Morganella morganii S2 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
NLDBIP_12610 NLDBIP_12610 70.4 Morganella morganii S4 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
LHKJJB_12470 LHKJJB_12470 70.4 Morganella morganii S3 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
HKOGLL_11085 HKOGLL_11085 70.4 Morganella morganii S5 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
F4V73_RS05775 F4V73_RS05775 70.8 Morganella psychrotolerans - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_1033

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1033

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45095 1.21e-59 195 41 4 268 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8YDH0 2.03e-59 195 41 4 273 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FUW8 2.03e-59 195 41 4 273 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 2.03e-59 195 41 4 273 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 2.03e-59 195 41 4 273 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
P0AAG2 2.3e-58 192 41 4 256 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 2.3e-58 192 41 4 256 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 2.3e-58 192 41 4 256 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
A0A0H2ZGN6 3.19e-58 191 43 4 267 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
P42064 1.59e-57 190 42 5 257 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
Q53193 6.77e-55 183 42 4 240 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P24136 1.15e-54 183 39 6 269 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
A2RI77 1.17e-53 180 38 7 286 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
P26905 3.02e-53 179 40 5 272 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
Q57RB2 1.22e-52 184 43 5 253 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 1.64e-35 137 38 8 267 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
A9CKL2 1.92e-52 182 41 6 265 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 1.85e-29 119 32 6 253 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0TJM0 3.09e-52 183 42 7 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 8.58e-40 149 39 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RE96 3.68e-52 182 42 7 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 1.4e-39 148 39 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q32IB5 4.04e-52 182 42 8 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 4.14e-39 147 39 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
A1A967 4.12e-52 182 42 7 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 8.72e-38 143 38 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q5PGP3 4.52e-52 182 43 5 253 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 9.52e-36 138 38 8 267 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8X6W1 4.76e-52 182 42 8 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 1.32e-39 148 39 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8ZQM4 4.91e-52 182 43 5 253 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 1.66e-35 137 38 8 267 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3Z3V4 5.39e-52 182 42 7 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 1.92e-40 150 40 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q323W5 5.5e-52 182 42 7 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 1.11e-39 149 40 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q8FJL0 1.59e-51 181 42 7 268 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 1.57e-39 148 39 8 272 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P04285 1.66e-51 174 38 6 265 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75796 1.84e-51 181 42 7 268 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 2.02e-40 150 40 8 272 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
Q8Z864 2.1e-51 181 43 5 253 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 1.61e-35 137 38 8 267 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
A5VU87 2.32e-51 174 41 7 267 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P77268 4.51e-51 173 37 5 274 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
Q2YK63 6.28e-51 173 41 7 267 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 6.28e-51 173 41 7 267 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
Q83LT3 7.62e-51 179 42 8 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 3.62e-40 150 39 8 271 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q8YBN6 9.33e-51 172 41 7 267 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP1 1.02e-50 172 41 7 267 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
P45052 1.47e-50 172 40 6 257 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0T6D3 2.82e-50 177 42 8 268 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 3.41e-40 150 39 8 271 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q6D3A9 3.39e-50 177 39 8 284 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 8.91e-35 135 35 7 266 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P76027 1.33e-49 169 38 8 284 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
P0A2U9 6.3e-49 168 39 4 237 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 6.3e-49 168 39 4 237 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q07733 2.11e-48 166 37 5 258 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
P50980 2.53e-48 166 37 5 258 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
P33916 3.08e-46 165 39 6 260 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 1.35e-37 142 37 6 258 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P45051 2.02e-44 156 37 7 268 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P08007 1.12e-43 154 40 8 243 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2FVF0 2.35e-43 151 37 4 236 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
P36636 3.52e-43 152 33 7 284 2 sapD Peptide transport system ATP-binding protein SapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3JXA3 6.48e-43 150 37 4 236 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
P77737 9.44e-43 152 39 8 243 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
P0AAH7 4.36e-42 150 32 7 284 3 sapD Peptide transport system ATP-binding protein SapD Shigella flexneri
P0AAH4 4.36e-42 150 32 7 284 1 sapD Putrescine export system ATP-binding protein SapD Escherichia coli (strain K12)
P0AAH5 4.36e-42 150 32 7 284 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAH6 4.36e-42 150 32 7 284 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O157:H7
P63396 1.32e-41 154 37 9 272 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 6.7e-30 121 35 6 239 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 1.32e-41 154 37 9 272 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 6.7e-30 121 35 6 239 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 1.32e-41 154 37 9 272 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 6.7e-30 121 35 6 239 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P42065 7.29e-40 144 37 4 244 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
C0SP98 1.32e-39 143 36 6 261 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
P37313 2.32e-39 143 37 5 236 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
P45094 2.53e-39 142 36 5 241 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45288 1.39e-38 141 31 6 279 3 sapD Peptide transport system ATP-binding protein SapD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H2ZH52 2.42e-38 140 38 5 236 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
P72479 4.97e-38 139 32 7 274 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q53194 5.24e-38 140 38 5 251 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0A2V5 1.5e-37 137 36 6 227 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 1.5e-37 137 36 6 227 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q8P2L5 1.59e-37 137 34 5 255 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
P24137 4.47e-37 136 34 6 255 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
P0CZ33 2.23e-36 134 34 5 255 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 2.23e-36 134 34 5 255 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 2.23e-36 134 34 5 255 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 2.23e-36 134 34 5 255 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
P75552 4.16e-36 136 32 5 264 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47325 3.16e-35 133 30 4 261 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q2YJJ8 3.53e-35 132 34 7 267 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 3.53e-35 132 34 7 267 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
P18766 1.74e-34 129 32 5 255 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8YDH1 1.96e-34 130 34 7 267 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8RDH4 4.63e-34 129 35 3 217 1 dppD Dipeptide transport ATP-binding protein DppD Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A2RI78 1.65e-33 127 31 6 257 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
Q8YBN5 4.34e-33 126 33 6 262 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 4.34e-33 126 33 6 262 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 4.34e-33 126 33 6 262 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 4.34e-33 126 33 6 262 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 4.34e-33 126 33 6 262 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YCN8 4.55e-33 124 35 7 257 3 nikD Nickel import ATP-binding protein NikD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S8 4.55e-33 124 35 7 257 3 nikD Nickel import ATP-binding protein NikD Brucella abortus biovar 1 (strain 9-941)
Q2YL70 4.55e-33 124 35 7 257 3 nikD Nickel import ATP-binding protein NikD Brucella abortus (strain 2308)
Q0SZJ4 5.74e-33 124 34 8 260 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q8FVM9 6.72e-33 124 35 7 259 2 nikD Nickel import ATP-binding protein NikD Brucella suis biovar 1 (strain 1330)
Q83J78 7.47e-33 124 34 8 260 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
Q3YW49 9.14e-33 123 34 8 260 3 nikD Nickel import ATP-binding protein NikD Shigella sonnei (strain Ss046)
Q31VE7 1.12e-32 123 34 8 260 3 nikD Nickel import ATP-binding protein NikD Shigella boydii serotype 4 (strain Sb227)
Q8X5U1 2.37e-32 122 34 8 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O157:H7
Q1R5D9 2.52e-32 122 34 8 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain UTI89 / UPEC)
Q0TBX9 2.52e-32 122 34 8 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P33593 3.77e-32 122 34 8 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain K12)
P77622 5.62e-32 123 32 5 259 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
Q32AQ2 6.26e-32 121 34 7 246 3 nikD Nickel import ATP-binding protein NikD Shigella dysenteriae serotype 1 (strain Sd197)
Q2RS22 8.08e-32 121 34 5 248 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6D5H7 1.19e-31 122 34 11 255 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8FCN0 1.41e-31 120 33 8 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2RS21 3.13e-31 119 31 7 269 3 nikD Nickel import ATP-binding protein NikD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5FKL2 2.55e-30 119 35 8 235 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q5PCG9 3.36e-30 119 33 10 256 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZR89 1.88e-29 117 33 10 258 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q31VE6 4.06e-29 114 38 4 211 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q32AQ1 6.44e-29 114 38 4 211 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
Q57S53 7.21e-29 115 33 10 256 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q1R5D8 8.55e-29 113 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 8.55e-29 113 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 8.55e-29 113 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3YW48 1.16e-28 113 37 4 211 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
P33594 1.23e-28 113 37 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q8X4L6 1.44e-28 113 37 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
P36638 2.57e-28 112 33 9 257 2 sapF Peptide transport system ATP-binding protein SapF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AAI0 4.15e-28 111 33 9 258 3 sapF Peptide transport system ATP-binding protein SapF Shigella flexneri
P0AAH8 4.15e-28 111 33 9 258 1 sapF Putrescine export system ATP-binding protein SapF Escherichia coli (strain K12)
P0AAH9 4.15e-28 111 33 9 258 3 sapF Peptide transport system ATP-binding protein SapF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3A9G5 6.59e-28 112 34 9 247 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q0SZJ3 6.93e-28 111 38 5 215 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q83J77 8.02e-28 110 38 5 215 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q8FVN0 1.2e-27 110 32 3 232 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q8Z8R5 1.44e-27 112 32 10 258 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q832Y6 4.62e-27 110 32 10 252 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8YCN7 4.63e-27 108 32 3 232 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 4.63e-27 108 32 3 232 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 4.63e-27 108 32 3 232 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q5M5Z2 5.59e-27 110 33 8 233 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q88HL1 8.64e-27 108 34 4 228 3 nikD Nickel import ATP-binding protein NikD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2FVF1 1.01e-26 107 32 7 238 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H3JT74 1.58e-26 107 33 8 238 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5M1F6 3.24e-26 108 33 8 233 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q93DA2 5.22e-26 108 33 11 242 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q74IV9 5.59e-26 107 31 8 243 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9S4Z0 8.34e-26 106 32 9 250 3 metN Methionine import ATP-binding protein MetN Salmonella enteritidis
Q04F14 1.03e-25 107 34 10 238 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6D3Q6 1.12e-25 106 32 10 256 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P0CZ31 1.59e-25 106 34 11 242 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 1.59e-25 106 34 11 242 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8E3S0 1.79e-25 106 32 10 250 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q1J8E4 2.07e-25 106 33 9 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q8DY54 2.24e-25 106 32 10 250 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 2.24e-25 106 32 10 250 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
O34392 2.47e-25 103 34 5 190 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q1JII9 2.72e-25 105 33 9 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q5XDS8 2.86e-25 105 34 11 242 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q1JNE0 2.92e-25 105 34 11 242 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 2.92e-25 105 34 11 242 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q88RL5 2.99e-25 105 32 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1IGZ0 3.15e-25 105 32 5 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q6HP89 3.6e-25 105 33 8 218 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q48V78 3.88e-25 105 33 9 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 3.88e-25 105 33 9 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q9CIN4 4.2e-25 105 32 10 244 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q81IN8 6.78e-25 104 33 8 218 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
D8KFN1 8.12e-25 105 30 10 244 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 8.12e-25 105 30 10 244 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q032A0 8.98e-25 104 31 10 248 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
Q8NWT5 9.01e-25 102 26 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MW2)
Q8P2K6 1.02e-24 104 33 9 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q7A5Q8 1.2e-24 102 27 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain N315)
Q99UA2 1.2e-24 102 27 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q81ZF5 1.34e-24 103 33 8 218 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q65M34 1.54e-24 103 34 8 241 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q73EL7 1.7e-24 103 33 8 218 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6GH27 1.73e-24 102 26 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MRSA252)
Q6G9I0 1.81e-24 102 26 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MSSA476)
Q5HG40 1.81e-24 102 26 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain COL)
Q2FYQ7 1.81e-24 102 26 5 252 1 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH57 1.81e-24 102 26 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain USA300)
P16678 1.95e-24 101 30 5 251 1 phnK Putative phosphonates utilization ATP-binding protein PhnK Escherichia coli (strain K12)
Q03Z27 2.11e-24 103 31 10 259 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q737I0 2.14e-24 105 31 9 230 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 5.34e-08 57 25 9 234 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63GR8 3.79e-24 102 33 8 218 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q8CQS7 4.32e-24 102 31 8 247 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 4.32e-24 102 31 8 247 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8G5P8 5.9e-24 103 31 11 254 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q6NJ07 6.72e-24 102 34 6 199 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
P54537 8.25e-24 99 31 7 229 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q3A558 9.97e-24 99 35 8 229 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q9HT70 1.3e-23 101 31 7 227 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 1.3e-23 101 31 7 227 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
O34697 1.79e-23 99 29 5 201 1 bceA Bacitracin export ATP-binding protein BceA Bacillus subtilis (strain 168)
Q043Y8 1.8e-23 100 31 7 228 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8YA75 1.84e-23 100 34 8 213 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q724C0 2.08e-23 100 34 8 213 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q81CT8 2.08e-23 102 31 9 225 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 1.95e-06 52 23 10 234 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A3DJK5 2.12e-23 99 31 7 204 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8EPK1 2.14e-23 100 34 10 232 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8GEH7 2.23e-23 100 38 9 214 3 metN Methionine import ATP-binding protein MetN Erwinia pyrifoliae (strain DSM 12162 / Ep1/96)
Q88HL0 2.37e-23 99 34 5 232 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q92EZ6 2.4e-23 100 34 6 211 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8FV85 2.56e-23 100 32 7 229 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 2.56e-23 100 32 7 229 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 2.56e-23 100 32 7 229 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 2.56e-23 100 32 7 229 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
P37774 2.74e-23 98 32 8 244 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q7A7E3 3.78e-23 100 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 3.78e-23 100 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1GZH6 3.93e-23 97 33 7 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q6G2E2 4.59e-23 99 33 6 215 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q52815 4.81e-23 98 29 7 233 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
O34979 4.9e-23 97 35 9 208 3 yvrO Uncharacterized ABC transporter ATP-binding protein YvrO Bacillus subtilis (strain 168)
Q6GJL2 5.29e-23 99 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q9A502 5.38e-23 99 36 6 195 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q13VD7 5.79e-23 99 32 10 249 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q0I354 6.8e-23 96 30 6 220 3 thiQ Thiamine import ATP-binding protein ThiQ Histophilus somni (strain 129Pt)
Q03A07 6.86e-23 99 36 7 195 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5HIL5 7.38e-23 99 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 7.38e-23 99 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 7.38e-23 99 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q2YXY9 8.32e-23 97 26 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NY21 8.5e-23 99 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 8.5e-23 99 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q5HV18 1.11e-22 98 32 8 248 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 1.11e-22 98 32 8 248 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5WKL3 1.13e-22 99 32 9 228 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
Q03P57 1.17e-22 99 31 8 235 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q88RB3 1.33e-22 99 32 7 219 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P61482 1.37e-22 96 35 10 237 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 1.37e-22 96 35 10 237 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 1.37e-22 96 35 10 237 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8RFN2 1.56e-22 98 32 5 198 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P47326 1.66e-22 100 35 2 148 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47326 2.91e-06 52 28 5 147 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q1BY14 1.78e-22 98 32 9 249 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 1.78e-22 98 32 9 249 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
O26096 2.32e-22 97 31 7 229 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q57QD7 2.58e-22 95 35 10 237 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q17VE0 2.81e-22 97 31 7 229 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q31ZH4 3.11e-22 95 35 10 237 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
P75370 3.16e-22 95 28 9 252 3 p29 Probable ABC transporter ATP-binding protein p29 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q1CR30 3.37e-22 97 32 7 216 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q2YVT7 3.57e-22 97 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q3Z300 3.95e-22 95 36 11 238 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 3.95e-22 95 36 11 238 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 3.95e-22 95 36 11 238 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 3.95e-22 95 36 11 238 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q5KVK2 4.08e-22 97 32 7 213 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q1IGN4 4.13e-22 97 32 7 219 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q83F44 4.21e-22 97 34 6 208 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A1U0A9 4.38e-22 99 32 10 250 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P75957 4.61e-22 94 36 11 238 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
P75551 4.9e-22 99 35 1 144 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75551 2.66e-06 52 29 6 147 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2SY12 5.27e-22 97 33 10 234 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8X8E3 5.33e-22 94 36 11 238 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q83LR7 5.68e-22 98 30 9 273 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q7N3A6 6.03e-22 94 34 8 237 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q81PZ8 6.77e-22 98 30 9 227 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 9.07e-09 59 25 9 234 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q63SP4 7.33e-22 94 33 6 202 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia pseudomallei (strain K96243)
Q62J04 7.33e-22 94 33 6 202 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia mallei (strain ATCC 23344)
Q65TB7 7.81e-22 94 32 9 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P10346 8.03e-22 94 30 6 222 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
O34900 8.77e-22 94 31 8 229 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q8NSN2 9.08e-22 96 33 6 199 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q5WJP0 1.01e-21 96 35 10 225 3 metN2 Methionine import ATP-binding protein MetN 2 Shouchella clausii (strain KSM-K16)
Q48PU6 1.15e-21 95 30 5 218 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q63S19 1.19e-21 95 32 9 231 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 1.19e-21 95 32 9 231 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 1.19e-21 95 32 9 231 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q9RR46 1.22e-21 96 33 6 210 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q7VM95 1.26e-21 95 30 12 288 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8Y0C6 1.34e-21 94 33 7 208 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P46920 1.36e-21 96 34 6 209 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
P55662 1.4e-21 94 29 6 232 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q83RS0 1.45e-21 93 35 10 237 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella flexneri
Q2SXD1 1.57e-21 94 33 6 202 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9ZJ34 1.8e-21 95 33 6 197 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q8EEV5 1.84e-21 93 35 8 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q254K9 2.01e-21 95 29 7 235 3 metN Methionine import ATP-binding protein MetN Chlamydia felis (strain Fe/C-56)
Q1LQF6 2.38e-21 95 30 11 252 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9CIS9 2.4e-21 94 34 12 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q14H97 2.77e-21 95 31 10 233 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q97T09 2.81e-21 95 32 9 233 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5NFU5 2.83e-21 95 31 10 233 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q7NTU0 2.97e-21 92 35 7 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P0A2U7 2.99e-21 92 30 6 220 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U6 2.99e-21 92 30 6 220 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04DA7 3.15e-21 94 31 8 233 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q0BMC9 3.56e-21 94 31 10 233 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 3.56e-21 94 31 10 233 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q39EV3 3.6e-21 92 31 6 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3KK97 3.7e-21 94 30 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q1WVG9 3.8e-21 94 32 9 228 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q0BH79 4.13e-21 94 31 9 249 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1BHS6 4.14e-21 92 31 6 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia orbicola (strain AU 1054)
P96063 4.17e-21 94 34 9 220 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32EX7 4.29e-21 92 35 11 238 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q87RS1 4.3e-21 94 32 9 249 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P9WQL5 4.53e-21 94 28 6 248 1 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL4 4.53e-21 94 28 6 248 3 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63358 4.53e-21 94 28 6 248 3 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8ZQE4 4.6e-21 95 32 9 229 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z824 4.69e-21 95 32 9 229 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q5PGK9 4.73e-21 95 32 9 229 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P54954 4.97e-21 92 30 8 236 1 yxeO Probable amino-acid import ATP-binding protein YxeO Bacillus subtilis (strain 168)
Q3KJS6 5.15e-21 94 32 9 229 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q9X196 5.19e-21 94 32 7 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8DRF9 6.26e-21 94 32 9 233 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q4KKK8 6.3e-21 94 31 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1DDP4 6.47e-21 93 34 10 236 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q7VV72 6.51e-21 94 31 10 254 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 6.51e-21 94 31 10 254 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 6.51e-21 94 31 10 254 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7MN25 6.55e-21 94 33 9 224 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q38UT9 6.72e-21 92 30 9 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8DFC3 7.03e-21 94 33 9 224 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q65VG9 7.26e-21 94 31 8 225 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VI92 8.26e-21 93 28 8 251 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9KTJ5 8.67e-21 93 35 7 200 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q02R79 8.78e-21 94 30 11 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8NQU4 9.02e-21 92 30 7 230 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q57SD6 9.06e-21 94 34 9 220 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q6HI76 9.63e-21 95 30 9 227 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 1.99e-08 58 25 10 234 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q831K6 1.06e-20 93 32 6 197 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q9HY19 1.07e-20 93 30 11 251 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q39IE7 1.19e-20 93 30 9 249 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P30769 1.3e-20 93 28 6 248 3 mkl Probable ribonucleotide transport ATP-binding protein mkl Mycobacterium leprae (strain TN)
Q4QMH4 1.38e-20 93 32 10 233 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q87UV4 1.43e-20 93 32 8 210 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q6FAN3 1.51e-20 93 34 7 200 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8ELQ6 1.6e-20 92 31 10 232 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q21BU8 1.62e-20 92 29 10 265 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q57R58 1.65e-20 94 31 9 229 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q32JQ8 1.66e-20 92 33 10 230 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q5PFQ7 1.87e-20 92 34 9 220 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8W8 1.89e-20 92 34 9 220 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q0HJG0 1.92e-20 90 36 7 208 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-4)
Q0HVQ0 1.94e-20 90 35 8 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-7)
Q7N6Z2 1.94e-20 92 30 7 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q46Y69 1.97e-20 92 30 10 251 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9KLQ5 1.99e-20 92 32 7 228 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45769 2.01e-20 90 29 8 228 3 yhdZ Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ Escherichia coli (strain K12)
Q667L9 2.07e-20 92 33 7 212 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q65P76 2.19e-20 91 30 9 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P30750 2.22e-20 92 33 10 230 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
A1K323 2.24e-20 94 31 10 244 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
A1VZQ5 2.25e-20 90 29 5 228 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q325U1 2.26e-20 92 33 10 230 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q3Z5F8 2.33e-20 92 33 10 230 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 2.33e-20 92 33 10 230 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 2.33e-20 92 33 10 230 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLD2 2.33e-20 92 34 9 216 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P63356 2.33e-20 92 33 10 230 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
P44785 2.34e-20 92 32 10 233 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5E715 2.43e-20 92 34 6 199 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5M243 2.51e-20 91 34 11 230 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 2.51e-20 91 34 11 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q0P9X7 2.63e-20 90 29 5 228 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6A6X6 3.01e-20 92 33 11 245 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q02ME3 3.07e-20 92 32 7 219 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9Z8Q8 3.29e-20 92 30 7 232 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q52666 3.29e-20 90 31 6 201 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q3Z3Q4 3.32e-20 93 30 9 273 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
P45247 3.67e-20 89 34 9 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 3.67e-20 89 34 9 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q897I2 3.69e-20 92 29 8 230 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
P72297 3.7e-20 90 32 8 234 3 occP Octopine permease ATP-binding protein P Rhizobium meliloti
Q03I82 3.7e-20 90 34 11 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q4KK46 3.73e-20 92 31 9 229 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1MQ44 3.86e-20 92 30 10 252 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
P75831 3.86e-20 93 30 9 273 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
Q92LX3 3.97e-20 92 31 10 247 3 metN Methionine import ATP-binding protein MetN Rhizobium meliloti (strain 1021)
Q1WSB9 4.06e-20 90 32 6 204 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q13X01 4.13e-20 90 31 6 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Paraburkholderia xenovorans (strain LB400)
Q44613 4.55e-20 89 31 7 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q032H4 4.56e-20 90 33 12 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 4.56e-20 90 33 12 239 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q8ELA5 4.6e-20 91 30 11 257 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2KVK2 4.94e-20 91 34 11 230 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q0KDG3 4.98e-20 91 32 10 232 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q57T09 5.02e-20 91 32 9 231 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q8TIX0 5.65e-20 90 31 12 243 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8ZRM9 5.89e-20 91 31 8 231 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83MC5 6.01e-20 91 33 10 230 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 6.01e-20 91 33 10 230 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q1IKM7 6.16e-20 89 33 7 220 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Koribacter versatilis (strain Ellin345)
Q8DMX9 7.05e-20 89 32 9 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 7.05e-20 89 32 9 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 7.05e-20 89 32 9 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8P4S7 7.62e-20 90 31 7 222 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 7.62e-20 90 31 7 222 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q8DWR3 7.74e-20 89 32 11 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 7.74e-20 89 32 11 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 7.74e-20 89 32 11 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q67JX4 7.96e-20 90 33 7 209 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8FRX8 8.03e-20 90 32 6 199 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8Y4L8 8.32e-20 90 32 7 213 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5PID0 8.52e-20 90 32 9 231 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5H503 8.76e-20 90 32 5 199 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q7UC29 8.77e-20 90 30 7 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
A1BCE9 8.8e-20 92 32 10 265 3 macB3 Macrolide export ATP-binding/permease protein MacB 3 Paracoccus denitrificans (strain Pd 1222)
Q8XBJ8 8.86e-20 90 30 7 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
P16676 9.31e-20 90 30 7 230 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q1BR30 9.36e-20 91 35 6 200 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 9.36e-20 91 35 6 200 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q5E0B3 9.43e-20 89 32 7 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q48PN3 9.81e-20 90 31 7 209 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8FFB3 1.01e-19 90 30 7 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XED0 1.1e-19 92 30 9 273 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
P27675 1.15e-19 88 30 7 213 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q323M3 1.15e-19 92 29 9 273 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q823C4 1.33e-19 90 30 9 235 3 metN Methionine import ATP-binding protein MetN Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q2P7S3 1.49e-19 90 32 5 199 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5YRD1 1.53e-19 90 30 8 235 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q9I190 1.55e-19 91 31 10 245 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P14175 1.69e-19 90 33 7 224 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
Q02MI4 1.72e-19 91 31 9 233 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain UCBPP-PA14)
Q47C66 1.75e-19 87 33 7 198 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Dechloromonas aromatica (strain RCB)
Q669P3 1.77e-19 87 32 8 232 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8Y455 1.81e-19 89 31 7 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8NWT6 1.81e-19 87 29 6 219 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MW2)
Q6G9I1 1.81e-19 87 29 6 219 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MSSA476)
Q5HQQ9 1.83e-19 89 33 9 218 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
E0SCY1 1.83e-19 90 34 8 225 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
P17328 1.87e-19 90 33 7 224 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1CFH7 1.87e-19 89 33 7 212 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 1.87e-19 89 33 7 212 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 1.87e-19 89 33 7 212 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q71WH8 1.88e-19 89 31 7 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q928L8 1.92e-19 89 33 9 226 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9G4F5 1.97e-19 89 32 7 230 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q927N9 1.98e-19 89 31 7 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q49W48 2.06e-19 89 33 7 200 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A088 2.06e-19 89 28 5 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 2.06e-19 89 28 5 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 2.06e-19 89 28 5 222 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 2.06e-19 89 28 5 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 2.06e-19 89 28 5 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 2.06e-19 89 28 5 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 2.06e-19 89 28 5 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
A0ALT6 2.1e-19 89 30 6 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q1CI46 2.13e-19 87 32 8 232 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 2.13e-19 87 32 8 232 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 2.13e-19 87 32 8 232 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q4FL37 2.14e-19 89 30 8 242 1 tmoW Trimethylamine N-oxide transport system ATP-binding protein TmoW Pelagibacter ubique (strain HTCC1062)
Q39AT4 2.22e-19 90 34 6 200 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8D3A0 2.26e-19 87 30 7 210 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Wigglesworthia glossinidia brevipalpis
Q8ENU2 2.3e-19 89 30 9 248 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q38WL5 2.3e-19 89 34 8 212 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q2YYM5 2.33e-19 88 28 5 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q0TJH0 2.36e-19 90 30 9 273 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q73F11 2.4e-19 89 31 8 230 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1RE44 2.45e-19 90 30 9 273 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
A1A9B7 2.45e-19 90 30 9 273 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
Q8DQH4 2.47e-19 87 33 7 206 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM82 2.47e-19 87 33 7 206 1 ftsE Cell division ATP-binding protein FtsE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q58206 2.56e-19 87 30 8 213 1 MJ0796 Uncharacterized ABC transporter ATP-binding protein MJ0796 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8Z990 2.57e-19 89 32 9 231 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q8U648 2.59e-19 88 28 9 276 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q81IZ6 2.63e-19 89 29 10 263 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5WET8 2.66e-19 88 33 9 218 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shouchella clausii (strain KSM-K16)
Q71X09 2.8e-19 89 32 7 213 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q9I1C8 2.86e-19 89 31 7 219 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WQK1 2.87e-19 87 29 9 234 1 Rv0986 Uncharacterized ABC transporter ATP-binding protein Rv0986 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQK0 2.87e-19 87 29 9 234 3 MT1014 Uncharacterized ABC transporter ATP-binding protein MT1014 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8CTB2 3.04e-19 89 33 9 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q88F88 3.73e-19 90 30 9 244 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q7A5Q9 3.79e-19 87 28 5 219 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain N315)
Q99UA3 3.79e-19 87 28 5 219 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q3BNZ3 3.87e-19 89 31 5 199 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q9L1C3 3.87e-19 89 34 7 204 3 metN Methionine import ATP-binding protein MetN Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6GH28 3.95e-19 87 29 6 219 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MRSA252)
O32169 4.05e-19 89 33 8 215 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q0I3Y9 4.07e-19 89 30 7 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q1LPJ9 4.14e-19 87 34 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6D1C4 4.22e-19 89 32 8 213 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8REG7 4.47e-19 87 26 6 228 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7VMV4 4.51e-19 86 33 8 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4JTG9 4.51e-19 89 31 7 215 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q895C4 5.06e-19 88 30 7 222 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
Q8XK20 5.12e-19 90 26 9 232 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 5.16e-08 57 25 7 212 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q7N8V0 5.13e-19 86 29 5 221 3 thiQ Thiamine import ATP-binding protein ThiQ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P77795 5.22e-19 88 33 11 230 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
Q0B6I6 5.23e-19 89 32 7 217 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q5HG41 5.26e-19 86 29 6 219 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain COL)
Q2FYQ8 5.26e-19 86 29 6 219 1 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH58 5.26e-19 86 29 6 219 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain USA300)
Q6GEL4 5.27e-19 87 26 6 246 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q668K6 5.4e-19 89 29 6 228 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7CS28 5.42e-19 88 31 8 211 1 smoE Sulfoquinovosyl glycerol transport ATP-binding protein SmoE Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9K789 5.44e-19 88 31 7 211 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6N9W0 5.51e-19 89 29 8 248 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q0BN75 5.72e-19 86 30 5 208 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain OSU18)
Q0I3C2 5.75e-19 86 33 9 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
Q8PYH5 5.92e-19 88 31 12 243 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PGE8 6.55e-19 88 31 5 199 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q4ZZK0 6.68e-19 88 30 6 201 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. syringae (strain B728a)
Q87UN4 7.99e-19 87 29 4 198 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q28VL7 8.21e-19 85 32 7 212 3 thiQ Thiamine import ATP-binding protein ThiQ Jannaschia sp. (strain CCS1)
O31711 8.99e-19 85 29 8 210 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q5WDP1 9.05e-19 87 31 8 215 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q9KD30 9.7e-19 86 27 6 229 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KIF7 9.84e-19 88 30 6 212 3 opuAA Glycine betaine transport ATP-binding protein OpuAA Lactococcus lactis subsp. lactis (strain IL1403)
Q2NU23 9.87e-19 85 32 8 231 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Sodalis glossinidius (strain morsitans)
Q6GDC0 9.93e-19 89 27 9 233 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q6GDC0 8.28e-07 53 25 8 221 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q4ZZR8 1.04e-18 87 30 4 193 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
D4GP38 1.08e-18 88 31 7 222 1 xacJ Xylose/arabinose import ATP-binding protein XacJ Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07180
Feature type CDS
Gene -
Product ABC transporter ATP-binding protein
Location 1570952 - 1571788 (strand: 1)
Length 837 (nucleotides) / 278 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1033
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0444 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component

Protein Sequence

MNKAPLIEVDNLCIDFPRARVVNNVSFQLGQERLALVGESGSGKSMTARSLMGLVRKPGKVSADKLHFMGDDLLAYSPKQWNQLRGKTISMVLQDPRYALNPVKTIYQQVEETVKLHQKLSHKDQHALITETLLSVGLPEQSISRYPGELSGGMGQRAMIAIALINNPTVLIADEPTSALDAQLRHQILELIITQCAQRDMALLLISHDLPLVAEYCDRVMVMYQGEQVDELEAKALPQATHPYTRTLWTCRPNASTYGTQLPVLDRTLNFKGTPYAN

Flanking regions ( +/- flanking 50bp)

TGCTTTTAACTTATTGGGTGATGGATTACGCGATGTATTAGGAGAAAGCCATGAATAAAGCCCCTTTAATCGAAGTCGATAATCTGTGTATTGATTTTCCACGTGCTAGAGTGGTGAATAATGTCTCCTTTCAGTTAGGACAAGAGCGGTTAGCGCTGGTGGGTGAATCTGGTTCAGGAAAATCGATGACGGCACGCTCATTAATGGGCTTAGTGCGTAAGCCGGGCAAAGTTTCTGCTGATAAATTGCATTTTATGGGGGACGATCTCCTCGCTTATTCTCCTAAGCAATGGAACCAGTTACGAGGAAAAACAATATCAATGGTATTACAAGATCCTCGTTATGCATTAAACCCAGTGAAAACCATTTATCAGCAAGTAGAAGAAACGGTAAAACTCCATCAAAAATTATCCCATAAAGATCAACATGCATTAATTACTGAAACTTTGCTTTCCGTGGGATTACCGGAACAGAGTATTTCTCGCTACCCCGGTGAATTATCGGGCGGTATGGGACAACGCGCGATGATCGCTATTGCGCTGATTAATAACCCAACGGTACTGATTGCGGATGAGCCAACTTCCGCACTAGATGCACAGCTACGACATCAAATATTAGAACTTATCATTACCCAATGCGCACAACGAGATATGGCTTTGTTGTTAATTAGCCATGATCTACCTTTAGTGGCTGAATATTGTGATCGTGTTATGGTCATGTATCAAGGGGAGCAAGTGGATGAACTTGAGGCAAAAGCATTACCTCAAGCCACACATCCATACACCCGCACCTTATGGACCTGTCGCCCTAATGCGAGTACCTATGGCACACAATTACCGGTATTAGATAGAACACTGAATTTTAAAGGTACACCTTATGCTAATTGATATTCATCATTTACGCGTTCAATTTGAACAAAATAGACAGATTAAGCAGG