Homologs in group_1033

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05320 FBDBKF_05320 90.1 Morganella morganii S1 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
EHELCC_12270 EHELCC_12270 90.1 Morganella morganii S2 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
NLDBIP_12610 NLDBIP_12610 90.1 Morganella morganii S4 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
LHKJJB_12470 LHKJJB_12470 90.1 Morganella morganii S3 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
HKOGLL_11085 HKOGLL_11085 90.1 Morganella morganii S5 dppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
PMI_RS07180 PMI_RS07180 70.8 Proteus mirabilis HI4320 - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_1033

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1033

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45095 1.66e-64 208 45 4 257 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42064 1.44e-59 195 41 5 257 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
P0AAG2 1.78e-58 192 43 4 257 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 1.78e-58 192 43 4 257 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 1.78e-58 192 43 4 257 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
A2RI77 1.11e-55 186 40 6 261 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
A0A0H2ZGN6 7.68e-55 183 44 5 257 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
P26905 4.64e-53 179 40 6 273 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
Q53193 9.71e-53 177 42 4 240 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8FUW8 1.1e-51 175 39 4 271 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 1.1e-51 175 39 4 271 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 1.1e-51 175 39 4 271 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
Q8YDH0 2.12e-51 174 39 4 271 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P24136 2.24e-51 175 37 6 269 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
P50980 1.19e-50 172 37 4 271 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
Q07733 1.37e-50 172 37 4 271 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
P75796 1.28e-49 176 42 8 274 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 7.63e-38 144 39 5 266 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
Q323W5 1.29e-49 176 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 2.87e-38 145 39 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q3Z3V4 1.53e-49 176 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 8.1e-38 144 39 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q57RB2 1.53e-49 176 46 6 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 4.04e-33 130 37 6 266 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q0TJM0 2.21e-49 175 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 3.43e-37 142 38 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RE96 2.55e-49 175 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 5.93e-37 141 38 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
A1A967 2.94e-49 175 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 2.98e-35 136 37 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q32IB5 3.65e-49 175 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 1.44e-36 140 38 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q8X6W1 3.69e-49 175 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 5.11e-37 141 38 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8FJL0 4.21e-49 174 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 5.7e-37 141 38 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A9CKL2 1.25e-48 172 40 7 271 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 1e-26 112 33 6 242 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
P33916 1.49e-48 171 40 5 263 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 7.84e-40 148 39 7 260 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
Q8ZQM4 1.86e-48 173 45 6 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 3.92e-33 130 37 6 266 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGP3 2.07e-48 172 45 6 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 1.91e-33 131 38 6 266 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q83LT3 4.78e-48 172 42 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 5.32e-37 141 38 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
P04285 5.25e-48 166 38 6 265 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z864 7.43e-48 171 45 6 243 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 4e-33 130 37 6 266 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
P76027 9.51e-48 165 39 6 256 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
Q6D3A9 1.21e-47 171 40 8 282 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 6.14e-35 135 37 7 268 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0T6D3 1.79e-47 170 41 8 274 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 5.01e-37 141 38 5 266 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
P45052 7.42e-47 162 39 6 257 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5VU87 4.38e-46 160 39 7 264 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8FWP1 1.94e-45 159 39 7 264 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
Q8YBN6 2.4e-45 159 39 7 264 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0A2U9 3.12e-45 159 35 6 257 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 3.12e-45 159 35 6 257 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q2YK63 1.16e-44 157 39 7 264 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 1.16e-44 157 39 7 264 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
P77268 7.92e-44 154 35 5 262 2 ddpD Probable D,D-dipeptide transport ATP-binding protein DdpD Escherichia coli (strain K12)
P08007 1.53e-40 146 39 7 242 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P36636 5.54e-40 144 32 7 274 2 sapD Peptide transport system ATP-binding protein SapD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P77737 8.86e-40 144 38 6 241 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
P72479 4.82e-39 141 33 8 283 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P0AAH7 6.36e-39 142 31 7 272 3 sapD Peptide transport system ATP-binding protein SapD Shigella flexneri
P0AAH4 6.36e-39 142 31 7 272 1 sapD Putrescine export system ATP-binding protein SapD Escherichia coli (strain K12)
P0AAH5 6.36e-39 142 31 7 272 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAH6 6.36e-39 142 31 7 272 3 sapD Peptide transport system ATP-binding protein SapD Escherichia coli O157:H7
Q2FVF0 7.34e-39 140 33 5 253 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A0H2ZH52 7.71e-39 141 36 5 246 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8P2L5 8.43e-39 140 33 5 274 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0CZ33 1.11e-38 140 33 5 274 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 1.11e-38 140 33 5 274 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 1.11e-38 140 33 5 274 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 1.11e-38 140 33 5 274 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
P24137 1.74e-38 140 36 8 261 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
P45051 2.24e-38 140 38 5 237 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H3JXA3 2.93e-38 138 33 5 253 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
P18766 4.95e-38 139 33 6 286 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P45094 5.71e-38 139 34 7 263 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37313 9.82e-38 139 35 6 264 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
P42065 1.77e-36 135 36 5 244 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
Q53194 2.13e-36 135 36 6 265 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P63396 2.73e-36 139 37 7 258 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 2.55e-26 111 34 5 236 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 2.73e-36 139 37 7 258 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 2.55e-26 111 34 5 236 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 2.73e-36 139 37 7 258 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 2.55e-26 111 34 5 236 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P75552 3.21e-35 134 31 7 269 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47325 3.39e-35 133 29 5 262 3 oppD Oligopeptide transport ATP-binding protein OppD Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P45288 7.51e-35 131 29 5 262 3 sapD Peptide transport system ATP-binding protein SapD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C0SP98 3.28e-33 127 34 6 257 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
A2RI78 5.71e-33 125 30 8 277 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
Q2RS22 8.65e-33 124 35 5 259 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8YCN8 1.56e-32 123 37 8 260 3 nikD Nickel import ATP-binding protein NikD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S8 1.56e-32 123 37 8 260 3 nikD Nickel import ATP-binding protein NikD Brucella abortus biovar 1 (strain 9-941)
Q2YL70 1.56e-32 123 37 8 260 3 nikD Nickel import ATP-binding protein NikD Brucella abortus (strain 2308)
Q8FVM9 2.31e-32 122 37 8 260 2 nikD Nickel import ATP-binding protein NikD Brucella suis biovar 1 (strain 1330)
Q2YJJ8 1.06e-31 122 35 5 240 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 1.06e-31 122 35 5 240 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
Q8FVN0 1.37e-31 120 35 3 232 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q8RDH4 1.67e-31 122 32 5 251 1 dppD Dipeptide transport ATP-binding protein DppD Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q32AQ1 2.38e-31 120 39 4 211 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
P0A2V5 2.53e-31 121 30 6 265 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 2.53e-31 121 30 6 265 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
Q8YDH1 4.65e-31 122 35 5 240 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YCN7 5.27e-31 119 35 3 232 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 5.27e-31 119 35 3 232 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 5.27e-31 119 35 3 232 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q3YW48 5.69e-31 119 38 4 211 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
P33594 5.87e-31 119 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q1R5D8 1.33e-30 118 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 1.33e-30 118 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 1.33e-30 118 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q31VE6 4.19e-30 117 38 4 211 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q2RS21 5.87e-30 116 34 6 254 3 nikD Nickel import ATP-binding protein NikD Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q83J77 8.82e-30 116 38 4 208 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
P77622 1.02e-29 117 32 6 283 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
Q83J78 1.22e-29 115 34 7 260 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri
Q254K9 1.66e-29 117 34 9 244 3 metN Methionine import ATP-binding protein MetN Chlamydia felis (strain Fe/C-56)
Q0SZJ4 1.77e-29 115 34 7 260 3 nikD Nickel import ATP-binding protein NikD Shigella flexneri serotype 5b (strain 8401)
Q31VE7 2.07e-29 115 35 8 260 3 nikD Nickel import ATP-binding protein NikD Shigella boydii serotype 4 (strain Sb227)
Q3YW49 2.23e-29 115 35 8 260 3 nikD Nickel import ATP-binding protein NikD Shigella sonnei (strain Ss046)
Q1R5D9 3.21e-29 114 33 7 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain UTI89 / UPEC)
Q0TBX9 3.21e-29 114 33 7 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8X5U1 3.39e-29 114 33 7 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O157:H7
Q8X4L6 3.91e-29 114 38 4 211 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
P33593 4.36e-29 114 33 7 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli (strain K12)
Q32AQ2 7.6e-29 113 34 6 246 3 nikD Nickel import ATP-binding protein NikD Shigella dysenteriae serotype 1 (strain Sd197)
Q8FCN0 1.31e-28 112 33 7 260 3 nikD Nickel import ATP-binding protein NikD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0SZJ3 1.8e-28 112 38 4 208 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q2FVF1 5.04e-28 111 27 6 253 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q832Y6 6.29e-28 113 33 8 226 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q88HL1 1.13e-27 110 33 4 241 3 nikD Nickel import ATP-binding protein NikD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8YBN5 1.15e-27 112 32 10 270 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 1.15e-27 112 32 10 270 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 1.15e-27 112 32 10 270 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 1.15e-27 112 32 10 270 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 1.15e-27 112 32 10 270 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A0A0H3JT74 1.27e-27 110 27 6 255 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
O34392 2.61e-27 108 35 6 190 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q6D5H7 3.43e-27 110 34 9 254 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5M1F6 4.81e-27 110 34 12 240 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q1J8E4 8.4e-27 110 33 12 246 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q5FKL2 8.45e-27 110 32 9 237 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
P54537 1.32e-26 107 32 8 231 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
P0CZ31 1.39e-26 109 35 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 1.39e-26 109 35 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q5M5Z2 1.74e-26 109 34 12 240 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q04F14 3.55e-26 108 33 10 235 3 metN1 Methionine import ATP-binding protein MetN 1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q5XDS8 3.66e-26 108 34 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q48V78 3.85e-26 108 34 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 3.85e-26 108 34 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q03Z27 4.14e-26 108 31 8 240 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1JNE0 4.18e-26 108 34 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 4.18e-26 108 34 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
P36638 1.27e-25 105 31 6 258 2 sapF Peptide transport system ATP-binding protein SapF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9Z8Q8 1.45e-25 106 31 8 235 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q63GR8 1.5e-25 106 34 7 216 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q8P2K6 2.03e-25 106 34 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q93DA2 3.01e-25 105 33 13 244 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q73EL7 3.28e-25 105 33 7 216 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1JII9 3.34e-25 105 32 10 242 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q3A9G5 3.64e-25 105 31 9 252 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q6HP89 4.41e-25 105 33 7 216 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
P0AAI0 4.54e-25 103 30 6 262 3 sapF Peptide transport system ATP-binding protein SapF Shigella flexneri
P0AAH8 4.54e-25 103 30 6 262 1 sapF Putrescine export system ATP-binding protein SapF Escherichia coli (strain K12)
P0AAH9 4.54e-25 103 30 6 262 3 sapF Peptide transport system ATP-binding protein SapF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q81IN8 6.11e-25 105 33 7 216 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81ZF5 1.15e-24 104 33 7 216 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q6G2E2 1.92e-24 103 34 6 211 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q74IV9 1.99e-24 103 32 8 231 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q032A0 2.7e-24 103 31 10 249 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
Q5HV18 3.08e-24 102 31 8 258 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 3.08e-24 102 31 8 258 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q03P57 3.24e-24 103 32 8 232 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8G5P8 3.48e-24 103 33 8 238 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q8NWT5 3.56e-24 101 27 5 253 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MW2)
Q8REG7 4.17e-24 100 29 9 236 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2YXY9 5.92e-24 100 27 5 252 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q58206 7.36e-24 99 29 7 229 1 MJ0796 Uncharacterized ABC transporter ATP-binding protein MJ0796 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6G9I0 7.66e-24 100 27 5 253 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MSSA476)
Q5HG40 7.66e-24 100 27 5 253 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain COL)
Q2FYQ7 7.66e-24 100 27 5 253 1 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH57 7.66e-24 100 27 5 253 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain USA300)
Q6D3Q6 8.57e-24 101 32 11 263 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7VI92 8.82e-24 102 32 12 256 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7A5Q8 1.12e-23 99 27 5 253 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain N315)
Q99UA2 1.12e-23 99 27 5 253 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q65TB7 1.21e-23 99 33 8 227 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5L5Z1 1.34e-23 101 30 8 242 3 metN Methionine import ATP-binding protein MetN Chlamydia abortus (strain DSM 27085 / S26/3)
Q04DA7 1.54e-23 101 32 10 238 3 metN2 Methionine import ATP-binding protein MetN 2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
D8KFN1 2.17e-23 101 31 10 249 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 2.17e-23 101 31 10 249 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q6GH27 2.71e-23 99 26 5 253 3 nikD Nickel import system ATP-binding protein NikD Staphylococcus aureus (strain MRSA252)
Q8NSN2 3.64e-23 100 34 6 199 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P45247 5.22e-23 97 33 8 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 5.22e-23 97 33 8 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q0I3C2 5.27e-23 97 31 8 226 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
Q9CIN4 6.18e-23 100 31 9 249 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q6NJ07 6.55e-23 99 33 7 214 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5YRD1 9.9e-23 99 36 6 199 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
Q823C4 1.02e-22 99 32 8 236 3 metN Methionine import ATP-binding protein MetN Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
O34697 1.21e-22 97 29 5 201 1 bceA Bacitracin export ATP-binding protein BceA Bacillus subtilis (strain 168)
A3DJK5 1.69e-22 97 28 8 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q88HL0 1.8e-22 97 35 5 232 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q83LR7 1.87e-22 100 31 10 283 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q8Y4L8 1.89e-22 98 32 10 253 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q4JTG9 1.94e-22 98 34 7 214 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q8EPK1 2e-22 98 32 10 232 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q71X09 2.18e-22 98 32 10 253 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria monocytogenes serotype 4b (strain F2365)
Q88RL5 3.24e-22 97 32 7 227 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5WKL3 3.38e-22 97 33 11 244 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
P55662 3.56e-22 95 30 6 242 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P47326 3.85e-22 99 34 1 148 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47326 8.37e-07 53 33 6 118 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q5PCG9 3.97e-22 97 31 7 232 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0I354 4.32e-22 94 31 7 224 3 thiQ Thiamine import ATP-binding protein ThiQ Histophilus somni (strain 129Pt)
Q7NTU0 4.37e-22 95 35 7 208 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8E3S0 4.87e-22 97 32 12 249 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q8ZR89 5.2e-22 97 31 7 232 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O26096 5.33e-22 96 31 7 222 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q88WA5 6.5e-22 97 30 9 246 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8DY54 7.06e-22 96 32 12 249 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 7.06e-22 96 32 12 249 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1CR30 8.56e-22 96 31 7 222 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q38UT9 8.64e-22 95 30 9 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
O34979 1.07e-21 94 33 7 198 3 yvrO Uncharacterized ABC transporter ATP-binding protein YvrO Bacillus subtilis (strain 168)
P75551 1.08e-21 98 34 1 150 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75551 1.13e-05 50 33 6 117 3 oppF Oligopeptide transport ATP-binding protein OppF Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8CQS7 1.09e-21 96 28 8 247 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 1.09e-21 96 28 8 247 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O32169 1.11e-21 96 35 7 210 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q8FV85 1.22e-21 96 30 10 273 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 1.22e-21 96 30 10 273 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 1.22e-21 96 30 10 273 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 1.22e-21 96 30 10 273 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q043Y8 1.26e-21 95 30 8 231 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q2YZ26 1.32e-21 93 33 8 227 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1WVG9 1.35e-21 95 32 10 234 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q6FAN3 1.54e-21 95 30 7 222 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0BMC9 1.59e-21 95 31 10 251 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 1.59e-21 95 31 10 251 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q7VZ31 1.69e-21 93 32 9 234 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W8T0 1.69e-21 93 32 9 234 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WK40 1.69e-21 93 32 9 234 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q57S53 1.71e-21 95 30 9 255 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q9CN78 1.78e-21 93 34 7 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q8GEH7 1.8e-21 95 36 7 209 3 metN Methionine import ATP-binding protein MetN Erwinia pyrifoliae (strain DSM 12162 / Ep1/96)
Q831K6 1.96e-21 95 34 6 203 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q9ZJ34 2e-21 95 30 7 222 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q65F80 2.67e-21 95 35 6 202 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A1VZQ5 3.32e-21 92 28 5 227 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q73F67 3.39e-21 93 30 9 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6GE75 5.72e-21 91 33 8 227 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain MRSA252)
Q8ELA5 6.26e-21 94 32 7 213 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0P9X7 6.54e-21 92 28 5 227 3 peb1C Probable ABC transporter ATP-binding protein PEB1C Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q57QD7 7.16e-21 91 34 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q8YA75 7.31e-21 94 31 9 241 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q6HPN0 8.23e-21 92 29 9 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 8.23e-21 92 29 9 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 8.23e-21 92 29 9 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
P16678 8.24e-21 92 28 4 251 1 phnK Putative phosphonates utilization ATP-binding protein PhnK Escherichia coli (strain K12)
Q17VE0 9.22e-21 93 31 7 222 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q724C0 1.02e-20 93 31 9 241 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q1IGN4 1.09e-20 93 31 10 248 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
P61482 1.15e-20 91 33 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 1.15e-20 91 33 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 1.15e-20 91 33 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6GDC0 1.16e-20 94 29 10 233 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q6GDC0 7.57e-12 68 26 10 256 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q52815 1.23e-20 91 29 8 249 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q39EV3 1.24e-20 91 33 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8RFN2 1.27e-20 93 33 7 203 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q81IZ6 1.38e-20 93 32 8 230 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q65M34 1.46e-20 92 31 8 216 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8NV47 1.52e-20 90 32 8 224 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain MW2)
Q6G6W1 1.52e-20 90 32 8 224 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain MSSA476)
A6QJK1 1.52e-20 90 32 8 224 2 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain Newman)
Q5HDJ6 1.52e-20 90 32 8 224 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain COL)
Q2FVR1 1.52e-20 90 32 8 224 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED7 1.52e-20 90 32 8 224 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain USA300)
Q63H62 1.58e-20 92 29 9 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q895C4 1.61e-20 92 30 9 229 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
Q7A3X3 1.67e-20 90 32 8 224 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain N315)
Q99RR8 1.67e-20 90 32 8 224 2 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1BHS6 1.9e-20 91 33 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia orbicola (strain AU 1054)
Q4KKK8 2.08e-20 92 32 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5WDP1 2.08e-20 92 31 7 229 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q5NFU5 2.13e-20 92 31 10 251 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q5HCL3 2.26e-20 94 29 10 233 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q5HCL3 3e-12 70 26 10 256 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q8UKE4 2.32e-20 94 32 10 235 3 macB Macrolide export ATP-binding/permease protein MacB Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8Z8R5 2.33e-20 92 31 7 232 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q14H97 2.35e-20 92 31 10 251 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q3Z300 2.41e-20 90 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 2.41e-20 90 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 2.41e-20 90 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 2.41e-20 90 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q99QV7 2.53e-20 94 29 10 233 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99QV7 3.17e-12 70 26 10 256 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A342 2.53e-20 94 29 10 233 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q7A342 3.17e-12 70 26 10 256 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q928L8 2.61e-20 92 31 8 229 3 metN2 Methionine import ATP-binding protein MetN 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O31711 2.68e-20 90 29 9 229 1 yknY Uncharacterized ABC transporter ATP-binding protein YknY Bacillus subtilis (strain 168)
Q1IGZ0 2.72e-20 92 31 6 225 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q8X8E3 2.93e-20 90 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q3Z3Q4 2.97e-20 94 31 10 283 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
P75831 3.02e-20 93 31 10 283 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
Q7A7E3 3.1e-20 92 29 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 3.1e-20 92 29 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2SMN9 3.21e-20 93 32 10 243 3 macB Macrolide export ATP-binding/permease protein MacB Hahella chejuensis (strain KCTC 2396)
P0A9U0 3.23e-20 90 34 6 201 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Shigella flexneri
P0A9T8 3.23e-20 90 34 6 201 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli (strain K12)
P0A9T9 3.23e-20 90 34 6 201 3 ybbA Uncharacterized ABC transporter ATP-binding protein YbbA Escherichia coli O157:H7
Q1RE44 3.23e-20 93 33 8 242 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
A1A9B7 3.23e-20 93 33 8 242 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
Q0TJH0 3.26e-20 93 33 8 242 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q4ZZK0 3.42e-20 92 32 8 224 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. syringae (strain B728a)
P75957 3.49e-20 90 32 8 236 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
Q97T09 3.55e-20 92 32 9 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q87UV4 3.92e-20 92 32 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q21BU8 3.93e-20 92 34 10 237 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q73R11 4.03e-20 93 29 8 231 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q9K619 4.18e-20 90 28 6 199 3 bceA Bacitracin export ATP-binding protein BceA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5WJP0 4.27e-20 91 34 10 217 3 metN2 Methionine import ATP-binding protein MetN 2 Shouchella clausii (strain KSM-K16)
Q92EZ6 4.42e-20 91 31 9 241 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P45092 4.59e-20 89 30 7 226 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8NUH8 5.98e-20 92 29 10 233 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q8NUH8 3.06e-12 70 26 10 256 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q6G5Z1 5.98e-20 92 29 10 233 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6G5Z1 3.06e-12 70 26 10 256 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6F0V4 5.99e-20 91 30 9 257 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q8G838 6.8e-20 92 34 9 226 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 2.47e-11 67 29 8 224 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8DRF9 6.9e-20 91 32 9 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q5ZWE4 7.95e-20 91 31 7 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8XED0 8.37e-20 92 32 9 251 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q7N3A6 8.59e-20 89 32 9 235 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9K789 8.97e-20 90 32 7 216 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2YVT7 9.01e-20 90 29 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q323M3 9.64e-20 92 30 10 283 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q44613 9.77e-20 88 31 8 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8NQU4 1.03e-19 89 30 7 239 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8ENU2 1.05e-19 90 33 8 227 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8R7Y5 1.06e-19 89 27 8 235 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q81CT8 1.09e-19 92 28 10 228 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7VMV4 1.11e-19 88 33 9 230 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5WXF0 1.13e-19 90 31 8 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q82VK1 1.17e-19 92 32 9 231 3 macB Macrolide export ATP-binding/permease protein MacB Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1QVQ7 1.17e-19 90 32 10 242 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q97UY8 1.23e-19 90 31 8 227 1 glcV Glucose import ATP-binding protein GlcV Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q81J16 1.34e-19 89 29 10 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q4QP85 1.37e-19 90 29 7 238 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q48PN3 1.39e-19 90 32 8 224 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5X627 1.41e-19 90 30 7 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q5QU46 1.42e-19 88 31 8 232 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q73F11 1.43e-19 90 32 8 230 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6F9P2 1.44e-19 90 29 12 253 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q88RB3 1.51e-19 90 30 8 251 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q7A5Q9 1.58e-19 88 26 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain N315)
Q99UA3 1.58e-19 88 26 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q18C09 1.68e-19 89 30 7 224 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
A1B677 1.77e-19 91 34 9 232 3 macB1 Macrolide export ATP-binding/permease protein MacB 1/2 Paracoccus denitrificans (strain Pd 1222)
Q6GJL2 1.94e-19 89 29 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
D4GP38 1.99e-19 90 29 5 223 1 xacJ Xylose/arabinose import ATP-binding protein XacJ Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q7UC29 2.05e-19 90 30 6 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
A0LM36 2.08e-19 91 33 9 218 3 macB Macrolide export ATP-binding/permease protein MacB Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q8XBJ8 2.35e-19 90 30 6 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q8FFB3 2.45e-19 89 30 6 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P16676 2.5e-19 89 30 6 224 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8NWT6 2.52e-19 87 27 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MW2)
Q6G9I1 2.52e-19 87 27 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MSSA476)
Q8FRX8 2.63e-19 89 32 6 199 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8NY21 2.88e-19 89 29 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 2.88e-19 89 29 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q7N6Z2 2.93e-19 89 29 7 243 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6A6X6 3.13e-19 89 31 9 231 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q0SFW6 3.18e-19 89 28 10 262 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
Q32EX7 3.26e-19 87 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q9CM47 3.44e-19 90 30 8 240 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q81XL3 3.59e-19 89 33 6 203 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus anthracis
Q631Y4 3.62e-19 89 33 6 203 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ZK / E33L)
Q815Y7 3.62e-19 89 33 6 203 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2RQQ0 3.85e-19 87 31 9 242 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q72Y96 3.96e-19 89 33 6 203 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q31ZH4 4.29e-19 87 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
Q6GH28 4.47e-19 87 26 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain MRSA252)
Q5M243 4.6e-19 87 28 11 283 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 4.6e-19 87 28 11 283 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q32DZ9 4.7e-19 90 30 10 283 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
Q5HG41 5.27e-19 86 26 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain COL)
Q2FYQ8 5.27e-19 86 26 6 247 1 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH58 5.27e-19 86 26 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain USA300)
Q8CRI7 5.35e-19 87 28 8 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM28 5.51e-19 87 28 8 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9S4Z0 6.11e-19 88 29 7 247 3 metN Methionine import ATP-binding protein MetN Salmonella enteritidis
Q57R58 6.46e-19 89 32 9 236 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q6HBS0 6.63e-19 88 33 6 203 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q03AH0 6.7e-19 88 31 9 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5HIL5 6.83e-19 88 28 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 6.83e-19 88 28 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 6.83e-19 88 28 7 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q5PFQ7 8.19e-19 88 32 9 250 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q668K6 8.31e-19 88 30 7 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
P45022 8.41e-19 86 28 9 238 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q03I82 8.6e-19 87 28 11 283 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q8VNL9 8.64e-19 87 27 9 267 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
P96063 8.86e-19 88 32 9 250 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q4L884 8.89e-19 87 26 5 204 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q8Z8W8 9.03e-19 88 32 9 250 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q8ZQE4 9.15e-19 89 32 9 236 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PGK9 9.15e-19 89 32 9 236 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2NRN5 9.77e-19 87 33 8 213 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q8Z824 9.78e-19 89 32 9 236 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q1WSB9 1e-18 87 29 7 203 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q7A470 1.01e-18 86 29 12 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 1.01e-18 86 29 12 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2SXD1 1.03e-18 86 32 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63SP4 1.07e-18 86 32 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia pseudomallei (strain K96243)
Q62J04 1.07e-18 86 32 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Burkholderia mallei (strain ATCC 23344)
Q1CFH7 1.08e-18 87 34 10 213 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 1.08e-18 87 34 10 213 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 1.08e-18 87 34 10 213 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1GZH6 1.1e-18 85 34 7 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q38WL5 1.11e-18 87 33 7 200 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q88ZZ2 1.13e-18 89 28 10 243 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 1.7e-12 70 28 10 236 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q13VD7 1.2e-18 87 30 8 250 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
P44513 1.29e-18 87 29 8 234 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6YRJ4 1.39e-18 89 26 8 228 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 3.21e-09 60 27 8 239 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q1WSB8 1.39e-18 86 27 8 233 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q88F88 1.42e-18 89 31 9 247 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5L3Q9 1.43e-18 86 28 5 200 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q1CGD7 1.52e-18 88 35 8 204 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q66CL2 1.52e-18 88 35 8 204 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7CHI2 1.52e-18 88 35 8 204 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis
Q1CA99 1.52e-18 88 35 8 204 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q7CJG3 1.55e-18 88 32 10 242 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q1C5W7 1.55e-18 88 32 10 242 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CJW8 1.55e-18 88 32 10 242 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q668L6 1.57e-18 88 32 10 242 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8DRR9 1.57e-18 86 26 10 271 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q31GF5 1.59e-18 85 30 8 241 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1RDS4 1.65e-18 85 32 8 225 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 1.65e-18 85 32 8 225 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q5L222 1.77e-18 87 28 9 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
P0A9S0 1.78e-18 85 32 9 226 3 ftsE Cell division ATP-binding protein FtsE Shigella flexneri
P0A9R7 1.78e-18 85 32 9 226 1 ftsE Cell division ATP-binding protein FtsE Escherichia coli (strain K12)
P0A9R8 1.78e-18 85 32 9 226 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9R9 1.78e-18 85 32 9 226 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O157:H7
Q1BR30 1.91e-18 87 33 9 224 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 1.91e-18 87 33 9 224 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q87RS1 1.93e-18 87 30 7 213 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q83RS0 1.96e-18 85 32 8 236 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella flexneri
Q667L9 2.09e-18 87 34 10 213 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q81VM2 2.13e-18 87 32 8 230 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q8NR42 2.33e-18 85 30 9 244 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q83F44 2.42e-18 87 34 7 202 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q8ELQ6 2.47e-18 86 30 7 222 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2S3A3 2.51e-18 85 35 6 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salinibacter ruber (strain DSM 13855 / M31)
Q62B84 2.62e-18 87 33 9 233 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia mallei (strain ATCC 23344)
Q57SD6 2.65e-18 87 31 9 250 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q3JHC9 2.86e-18 87 33 9 233 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain 1710b)
Q5KVK2 2.89e-18 86 34 8 217 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q8Z4V6 2.95e-18 86 29 6 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q02R79 2.95e-18 86 30 10 260 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HY19 3.01e-18 86 30 10 260 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q63H29 3.13e-18 86 31 8 230 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q8DFC3 3.16e-18 86 30 8 216 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q7MN25 3.23e-18 86 30 8 216 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q3SQZ1 3.31e-18 87 32 9 236 3 macB Macrolide export ATP-binding/permease protein MacB Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
P40860 3.41e-18 86 29 6 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1I7I9 3.43e-18 87 30 10 248 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
P48243 3.43e-18 84 28 7 221 1 gluA Glutamate transport ATP-binding protein GluA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q6GEL3 3.47e-18 85 29 12 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q737I0 3.51e-18 87 28 9 227 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q3KJS6 3.56e-18 86 32 11 226 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q6D664 3.6e-18 84 33 8 233 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6AE21 3.7e-18 86 32 6 199 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q2YYM4 3.72e-18 85 29 12 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8D0W8 3.73e-18 86 30 7 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q4KK46 3.74e-18 86 30 8 221 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1B9H9 3.84e-18 84 29 6 227 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
Q1BPZ6 4.29e-18 87 30 10 244 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia orbicola (strain AU 1054)
A0B212 4.41e-18 87 30 10 237 3 macB Macrolide export ATP-binding/permease protein MacB Burkholderia cenocepacia (strain HI2424)
Q39AT4 4.44e-18 86 33 9 224 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1M7A6 4.84e-18 84 29 8 231 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q52666 5.13e-18 84 28 7 230 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q0C1C3 5.16e-18 84 31 7 203 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
P10346 5.18e-18 84 29 7 224 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q63NI4 5.48e-18 86 33 8 218 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain K96243)
Q9CIS9 5.85e-18 84 27 10 275 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q0B6I6 5.9e-18 86 31 9 237 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q6LR20 5.94e-18 85 30 10 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q8T664 6.09e-18 86 30 7 202 3 abcH2 ABC transporter H family member 2 Dictyostelium discoideum
Q6LN52 6.62e-18 85 29 9 237 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q134N9 6.76e-18 85 32 7 213 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
A0KMJ3 6.9e-18 86 32 10 231 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q839D5 7.07e-18 84 27 7 233 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q5HDY6 7.17e-18 84 28 12 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 7.17e-18 84 28 12 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 7.17e-18 84 28 12 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q5L3R0 7.22e-18 84 30 9 236 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q5E0B3 7.28e-18 84 30 8 243 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0TJC1 7.32e-18 84 32 8 225 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q65VG9 7.75e-18 85 28 8 237 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8XK20 7.84e-18 86 23 9 242 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 2.31e-09 61 23 10 235 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8DY60 8.04e-18 86 28 13 259 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 3.7e-09 60 25 8 234 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q5SLN1 8.33e-18 84 30 10 262 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8E3S6 8.43e-18 86 28 13 259 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 2.94e-09 60 24 8 234 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q3A558 8.96e-18 83 31 7 227 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2YXZ0 9.22e-18 83 26 6 247 3 nikE Nickel import system ATP-binding protein NikE Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q13X01 1.03e-17 83 31 5 202 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Paraburkholderia xenovorans (strain LB400)
Q72AQ6 1.04e-17 84 31 10 239 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O83658 1.04e-17 85 29 9 258 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
Q0I3Y9 1.07e-17 85 28 9 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q2RPB4 1.11e-17 86 32 11 239 3 macB Macrolide export ATP-binding/permease protein MacB Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q65P76 1.11e-17 84 27 7 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q0BH79 1.13e-17 85 30 8 235 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q6D8T5 1.13e-17 86 31 11 266 3 macB Macrolide export ATP-binding/permease protein MacB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O34900 1.15e-17 83 29 6 227 1 tcyN L-cystine import ATP-binding protein TcyN Bacillus subtilis (strain 168)
Q5WVL8 1.16e-17 84 31 10 229 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q48CA0 1.18e-17 84 31 6 220 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6D1C4 1.19e-17 84 34 10 215 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1U0A9 1.28e-17 85 29 10 244 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P37774 1.35e-17 83 29 8 247 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05775
Feature type CDS
Gene -
Product ABC transporter ATP-binding protein
Location 1228113 - 1228961 (strand: 1)
Length 849 (nucleotides) / 282 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1033
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0444 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component

Protein Sequence

MTEPLIRVKNLSVDYPRARVVNSISFNLGQERLALVGESGSGKSMTARALMGLVRKPGKVSAQTLEFHNTPLLSLREKQWAALRGNDIAMIMQDPRYALNPVKNLYQQIEEALVRHQRLSKSDRRDRVYDMARAAGLAESALSRYPGQLSGGMGQRAMIAIALINNPAVLIADEPTSALDARLRHQILELIVRQCEERRMGLLLISHDLPLVAAHCQRVMVMYQGQQVDELPAAQLPQATHPYTRTLWTCRPDAQTYGTDLPVLDRQALQTLLTQETHHAGK

Flanking regions ( +/- flanking 50bp)

GGCATTCAATCTTCTGGGTGATGGTTTACGCGATATTATGGAGCCTGAACATGACTGAGCCACTTATCCGTGTCAAAAACCTGTCAGTGGATTATCCGCGTGCGCGGGTGGTCAACAGCATTTCATTTAACCTGGGACAGGAACGGCTGGCGCTGGTCGGCGAATCCGGCTCCGGTAAATCCATGACGGCGAGAGCACTGATGGGGCTGGTGCGCAAACCCGGCAAAGTCAGTGCGCAAACGCTGGAATTTCATAATACCCCGCTGCTGTCATTGCGTGAAAAACAGTGGGCGGCACTGCGCGGTAATGATATCGCCATGATAATGCAGGATCCGCGTTATGCCCTCAATCCGGTAAAAAATCTGTATCAGCAGATTGAAGAAGCGCTGGTGCGGCATCAGAGGCTGTCAAAATCTGACCGTCGTGACCGCGTATATGACATGGCGCGTGCAGCCGGGCTGGCAGAATCCGCCCTTTCCCGCTATCCGGGGCAACTTTCCGGCGGAATGGGGCAGCGCGCCATGATTGCAATTGCCCTGATCAATAATCCCGCGGTATTAATTGCCGACGAACCAACCTCAGCACTGGATGCACGGCTGCGCCATCAAATCCTGGAGCTGATTGTCCGCCAGTGTGAGGAGCGCCGGATGGGATTGCTGCTGATAAGCCACGACCTGCCGCTGGTCGCCGCTCATTGTCAGCGCGTGATGGTGATGTATCAGGGGCAGCAGGTGGATGAGCTGCCCGCCGCACAACTGCCGCAGGCAACACATCCCTATACCCGCACCTTGTGGACCTGCCGCCCGGATGCTCAGACTTACGGGACGGACTTACCGGTACTGGACAGACAGGCGTTGCAGACTTTACTGACTCAGGAGACTCATCATGCCGGAAAATAATCCAGCGCCGATTATTGAGGTTAATAATCTTTCCGTCAGTTTCGGGCAGC