Homologs in group_3126

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20015 FBDBKF_20015 35.8 Morganella morganii S1 - Type-1A pilin
EHELCC_03515 EHELCC_03515 35.8 Morganella morganii S2 - Type-1A pilin
NLDBIP_03515 NLDBIP_03515 35.8 Morganella morganii S4 - Type-1A pilin
LHKJJB_09345 LHKJJB_09345 35.8 Morganella morganii S3 - Type-1A pilin
HKOGLL_09630 HKOGLL_09630 35.8 Morganella morganii S5 - Type-1A pilin

Distribution of the homologs in the orthogroup group_3126

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3126

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P39264 6.57e-27 103 31 2 177 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P37922 1.05e-22 92 31 2 157 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q08456 1.48e-22 92 31 2 157 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P37921 9.52e-21 87 26 4 186 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37920 8.22e-19 82 26 5 186 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P55223 2.45e-18 81 26 4 186 3 None Fimbrial subunit type 1 Salmonella typhimurium
P43660 2.8e-18 80 30 0 150 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5K5 1.62e-14 70 30 2 152 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P08189 8.56e-12 63 25 3 154 1 fimF Protein FimF Escherichia coli (strain K12)
P0ABW5 8.63e-12 63 26 2 156 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 8.63e-12 63 26 2 156 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
P75855 1.5e-11 63 25 5 183 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P77789 1.71e-11 62 30 6 188 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P12730 5.4e-11 61 28 6 189 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P62605 9.96e-11 60 25 4 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 9.96e-11 60 25 4 182 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X582 1.91e-10 60 25 5 183 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P12903 1.35e-09 57 27 5 161 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P75859 1.37e-09 57 23 5 184 2 ycbU Uncharacterized fimbrial-like protein YcbU Escherichia coli (strain K12)
Q47223 9.58e-09 55 26 4 162 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P13429 1.31e-06 49 27 4 151 1 sfaG S-fimbrial protein subunit SfaG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P11312 1.53e-06 49 28 6 161 3 F17a-A F17 fimbrial protein Escherichia coli
P38052 6.57e-06 47 25 4 148 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P37926 8.36e-06 47 26 5 171 3 fimF Fimbrial-like protein FimF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12266 2.12e-05 46 24 3 140 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P04128 5.35e-05 45 23 3 133 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P42913 6.95e-05 45 36 0 60 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P13421 7.17e-05 44 26 5 179 1 smfA Fimbria A protein Serratia marcescens
P22595 9.93e-05 44 23 3 165 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P45988 0.000277 43 25 6 216 3 hifA Major fimbrial subunit Haemophilus influenzae

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07105
Feature type CDS
Gene -
Product fimbrial protein
Location 1552174 - 1552716 (strand: -1)
Length 543 (nucleotides) / 180 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3126
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07351 fimbrial protein - -

Protein Sequence

MKYSLIYSIVLFFTLSFTAYSNDRENISLDDGIVTFKGGIVEPACTVSSESEYQIVDLGVISSNQFHGVGSHSIKIPFFIKLMGCNKSITDKVSIIIIGDVNNNDKRLFSITDQQNSASGLGVALFNDEGEIIIPNKFNKYKFIEENELKLKFKASYLATKENVIGGKADSVVWFVFNYQ

Flanking regions ( +/- flanking 50bp)

TAATTTAAAGTATGACCTGATAAAGGTCATACTTTTATATCGAGGGAAATATGAAATATAGTTTAATATATTCTATTGTCCTATTTTTTACTCTTTCATTTACAGCCTATTCTAATGACAGGGAAAATATTTCTTTAGACGATGGTATTGTGACTTTTAAAGGGGGAATTGTAGAGCCTGCTTGTACAGTATCTTCTGAAAGTGAATATCAAATTGTTGATCTTGGTGTTATTAGTAGTAACCAATTTCATGGAGTAGGAAGTCACTCTATAAAAATCCCATTTTTTATTAAATTAATGGGATGTAATAAAAGTATTACGGATAAAGTCAGTATAATTATTATAGGTGATGTAAACAATAATGATAAACGATTATTTAGCATCACCGATCAACAAAATTCAGCTTCAGGATTAGGTGTTGCATTATTTAATGATGAAGGTGAAATAATTATTCCTAATAAATTCAATAAGTATAAATTTATTGAAGAGAATGAATTAAAACTAAAATTTAAAGCAAGTTATCTGGCAACGAAAGAAAACGTTATCGGTGGAAAAGCTGACAGCGTAGTTTGGTTTGTTTTCAATTATCAATAAATAAACCTATCATTTGAGGTTAATATGCATTTAATATCTAAACACTTTAT