Homologs in group_448

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01750 FBDBKF_01750 63.4 Morganella morganii S1 uspA Nucleotide-binding universal stress protein, UspA family
EHELCC_02220 EHELCC_02220 63.4 Morganella morganii S2 uspA Nucleotide-binding universal stress protein, UspA family
NLDBIP_01240 NLDBIP_01240 63.4 Morganella morganii S4 uspA Nucleotide-binding universal stress protein, UspA family
LHKJJB_00795 LHKJJB_00795 63.4 Morganella morganii S3 uspA Nucleotide-binding universal stress protein, UspA family
HKOGLL_00835 HKOGLL_00835 63.4 Morganella morganii S5 uspA Nucleotide-binding universal stress protein, UspA family
F4V73_RS04080 F4V73_RS04080 63.4 Morganella psychrotolerans - universal stress protein

Distribution of the homologs in the orthogroup group_448

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_448

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P39177 6.29e-34 119 44 3 145 1 uspG Universal stress protein UP12 Escherichia coli (strain K12)
Q8XBT3 2.37e-33 117 43 3 145 3 uspG Universal stress protein G Escherichia coli O157:H7
Q8FK07 7.37e-33 115 42 3 145 3 uspG Universal stress protein G Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83M07 1.86e-32 115 42 3 145 3 uspG Universal stress protein G Shigella flexneri
P67091 6.37e-32 113 39 2 148 1 uspF Universal stress protein F Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67092 6.37e-32 113 39 2 148 3 uspF Universal stress protein F Salmonella typhi
P67093 1.18e-31 112 41 3 145 3 uspG Universal stress protein G Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67094 1.18e-31 112 41 3 145 3 uspG Universal stress protein G Salmonella typhi
P37903 1.35e-30 110 39 2 148 1 uspF Universal stress protein F Escherichia coli (strain K12)
P0A4P8 1.4e-30 110 39 2 148 3 uspF Universal stress protein F Shigella flexneri
P0A4P6 1.4e-30 110 39 2 148 3 uspF Universal stress protein F Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TI19 1.4e-30 110 39 2 148 3 uspF Universal stress protein F Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0A4P7 1.4e-30 110 39 2 148 3 uspF Universal stress protein F Escherichia coli O157:H7
Q57951 7.91e-09 54 31 6 151 3 MJ0531 Universal stress protein MJ0531 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P74148 2.21e-08 53 27 4 153 3 sll1388 Universal stress protein Sll1388 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q83AC1 2.16e-06 47 31 5 149 3 uspA1 Universal stress protein A homolog 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q50777 2.28e-06 47 23 4 148 3 MTBMA_c15380 Universal stress protein MTBMA_c15380 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O27222 9.75e-06 45 24 4 148 3 MTH_1154 Universal stress protein MTH_1154 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q57997 1.02e-05 46 28 7 160 1 MJ0577 Universal stress protein MJ0577 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2FXL6 2.74e-05 45 31 5 146 3 SAOUHSC_01819 Putative universal stress protein SAOUHSC_01819 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GFZ7 2.74e-05 45 31 5 146 3 SAR1788 Putative universal stress protein SAR1788 Staphylococcus aureus (strain MRSA252)
Q5HF64 2.74e-05 45 31 5 146 3 SACOL1759 Putative universal stress protein SACOL1759 Staphylococcus aureus (strain COL)
Q99TF3 2.74e-05 45 31 5 146 3 SAV1710 Putative universal stress protein SAV1710 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FG28 2.74e-05 45 31 5 146 3 SAUSA300_1656 Putative universal stress protein SAUSA300_1656 Staphylococcus aureus (strain USA300)
Q7A0N0 2.74e-05 45 31 5 146 3 MW1653 Putative universal stress protein MW1653 Staphylococcus aureus (strain MW2)
Q6G8L7 2.74e-05 45 31 5 146 3 SAS1637 Putative universal stress protein SAS1637 Staphylococcus aureus (strain MSSA476)
Q2YTD0 2.74e-05 45 31 5 146 3 SAB1569 Putative universal stress protein SAB1569 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A551 2.74e-05 45 31 5 146 1 SA1532 Putative universal stress protein SA1532 Staphylococcus aureus (strain N315)
P45680 3.16e-05 44 28 6 153 1 uspA2 Universal stress protein A homolog 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07010
Feature type CDS
Gene -
Product universal stress protein
Location 1531297 - 1531734 (strand: -1)
Length 438 (nucleotides) / 145 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_448
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00582 Universal stress protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0589 Signal transduction mechanisms (T) T Nucleotide-binding universal stress protein, UspA family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11932 universal stress protein G - -

Protein Sequence

MYKTILVPVDISEDELTEKALQHAVYIAKLEGAKIHLFHAIPDVSRFSISYSYHYDMLSSFANKAIERVQEQLQELANSVDLPKEQVDFSAAFGSARDKVLELAEKIKADLIVVGSRRPSISTHLLGSNASGIVAYAKQSVLVVR

Flanking regions ( +/- flanking 50bp)

TGAAAAAATCAAAATAACAAACAGACGATAATTAATAATGAGGAGTTGCTATGTATAAGACAATTCTAGTGCCTGTGGATATTTCAGAAGATGAATTAACCGAAAAGGCTTTACAACACGCTGTTTATATTGCAAAGCTTGAAGGGGCTAAGATCCATTTGTTTCATGCTATTCCTGATGTTTCACGTTTTTCAATTAGTTATAGCTACCATTATGATATGTTAAGCTCTTTTGCTAATAAAGCGATTGAACGAGTTCAAGAACAACTGCAAGAATTAGCTAATTCTGTAGATTTACCTAAAGAGCAAGTTGATTTCTCTGCCGCATTTGGCTCAGCAAGAGATAAAGTGTTAGAGCTGGCAGAAAAAATTAAAGCGGATTTAATTGTCGTTGGCTCTCGTCGTCCTAGCATTTCAACTCATTTATTAGGCTCTAATGCATCAGGAATTGTGGCTTACGCCAAACAATCTGTGTTGGTTGTGCGTTAATCCTATAAGCGATGAAATAGGCTAACATCATAGTATAATATGGTATAAAA