Homologs in group_316

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12300 FBDBKF_12300 31.7 Morganella morganii S1 yhaH DUF805 domain-containing protein
EHELCC_14005 EHELCC_14005 31.7 Morganella morganii S2 yhaH DUF805 domain-containing protein
NLDBIP_15100 NLDBIP_15100 31.7 Morganella morganii S4 yhaH DUF805 domain-containing protein
LHKJJB_15510 LHKJJB_15510 31.7 Morganella morganii S3 yhaH DUF805 domain-containing protein
HKOGLL_14630 HKOGLL_14630 31.7 Morganella morganii S5 yhaH DUF805 domain-containing protein
F4V73_RS17130 F4V73_RS17130 31.7 Morganella psychrotolerans - DUF805 domain-containing protein
PMI_RS15860 PMI_RS15860 34.7 Proteus mirabilis HI4320 - DUF805 domain-containing protein

Distribution of the homologs in the orthogroup group_316

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_316

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64590 2.4e-33 115 50 3 126 1 yhaH Inner membrane protein YhaH Escherichia coli (strain K12)
P64591 2.4e-33 115 50 3 126 3 yhaH Inner membrane protein YhaH Escherichia coli O157:H7
P64592 6.01e-33 114 46 2 126 1 yhaI Inner membrane protein YhaI Escherichia coli (strain K12)
P64593 6.01e-33 114 46 2 126 3 yhaI Inner membrane protein YhaI Escherichia coli O157:H7
P0AF34 4.82e-05 43 27 6 139 4 yiiR Uncharacterized protein YiiR Escherichia coli (strain K12)
P0AF35 4.82e-05 43 27 6 139 4 yiiR Uncharacterized protein YiiR Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06955
Feature type CDS
Gene -
Product DUF805 domain-containing protein
Location 1522540 - 1522923 (strand: 1)
Length 384 (nucleotides) / 127 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_316
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF05656 Protein of unknown function (DUF805)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3152 Function unknown (S) S Uncharacterized membrane protein YhaH, DUF805 family

Protein Sequence

MNWYLEVIKNNYANFSGRARRKEYWMFIVVNTIILAVLYGIMFSSIDSYTGEMSGTGFAALIIIGIYSLATIIPNIAVTVRRFHDQDRSGWMILLSFIPFVGGLILFIFMCLDGTRGENRFGLDPKA

Flanking regions ( +/- flanking 50bp)

AGAGATTAACCTAAATCTATGTATTTTTACTATTGAATTAAGGATGAAAAATGAATTGGTACTTAGAGGTTATTAAAAATAATTATGCTAATTTTTCAGGTCGTGCGCGTCGAAAAGAATATTGGATGTTTATAGTGGTAAATACCATTATTTTAGCTGTGTTATATGGGATCATGTTCTCTTCTATCGACAGTTATACTGGTGAAATGAGTGGTACAGGCTTTGCTGCTTTGATTATTATCGGTATCTACTCTTTAGCAACTATTATTCCTAATATTGCCGTGACAGTGCGCCGTTTTCATGACCAAGATAGATCTGGTTGGATGATTTTATTATCATTTATTCCTTTCGTTGGCGGACTGATCCTGTTTATTTTTATGTGCTTAGATGGTACTAGAGGTGAAAATAGATTTGGTCTTGATCCTAAAGCCTAATAGCTAATTAATTTCTATCTTAATACAGTGAGTAAACTATTTATATAATT