Homologs in group_350

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12300 FBDBKF_12300 84.5 Morganella morganii S1 yhaH DUF805 domain-containing protein
EHELCC_14005 EHELCC_14005 84.5 Morganella morganii S2 yhaH DUF805 domain-containing protein
NLDBIP_15100 NLDBIP_15100 84.5 Morganella morganii S4 yhaH DUF805 domain-containing protein
LHKJJB_15510 LHKJJB_15510 84.5 Morganella morganii S3 yhaH DUF805 domain-containing protein
HKOGLL_14630 HKOGLL_14630 84.5 Morganella morganii S5 yhaH DUF805 domain-containing protein
PMI_RS06955 PMI_RS06955 31.7 Proteus mirabilis HI4320 - DUF805 domain-containing protein
PMI_RS15860 PMI_RS15860 50.7 Proteus mirabilis HI4320 - DUF805 domain-containing protein

Distribution of the homologs in the orthogroup group_350

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_350

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AF34 3.35e-35 122 42 1 143 4 yiiR Uncharacterized protein YiiR Escherichia coli (strain K12)
P0AF35 3.35e-35 122 42 1 143 4 yiiR Uncharacterized protein YiiR Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17130
Feature type CDS
Gene -
Product DUF805 domain-containing protein
Location 56280 - 56708 (strand: -1)
Length 429 (nucleotides) / 142 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_350
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF05656 Protein of unknown function (DUF805)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3152 Function unknown (S) S Uncharacterized membrane protein YhaH, DUF805 family

Protein Sequence

MTLQQWAFSFHGRISRKAFWAGIGLCGAVLFLLMSAQGLFQLPVEIIMVPVVIVLYPAAAIFTKRLHDRNKRGGWSLLLLVAWGLTTPDWSIAGDFMQWGLGRFLPVFIVMMMVLDCGVFKSVDEGNRFGEETDPVDKIDNR

Flanking regions ( +/- flanking 50bp)

CAGTTTGAATGAATAAGGGTATAACCAGTGTACACGATTAGGAAAGAAAAATGACACTACAACAATGGGCATTTTCGTTTCACGGACGGATCAGCCGTAAAGCATTTTGGGCGGGGATCGGGCTGTGCGGCGCAGTGCTGTTTCTCCTGATGTCTGCACAGGGGCTGTTTCAGTTACCGGTTGAAATTATTATGGTGCCGGTGGTGATTGTCCTGTATCCCGCGGCTGCCATTTTTACCAAACGTTTGCATGATCGCAACAAGCGCGGCGGCTGGTCATTATTACTGCTGGTGGCATGGGGGCTGACCACGCCGGACTGGAGTATTGCCGGTGACTTTATGCAGTGGGGACTGGGGCGTTTTCTGCCGGTCTTTATTGTGATGATGATGGTACTGGACTGCGGCGTGTTTAAAAGTGTGGATGAAGGCAACCGGTTCGGGGAAGAGACGGACCCGGTTGATAAAATCGATAACCGCTGATGTTATCCGTCCGGTGAATTCTGATAGCGCCATCCGTGGCGCAACGGCAG