Homologs in group_1792

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13305 FBDBKF_13305 49.1 Morganella morganii S1 chuT ABC-type hemin transport system, periplasmic component
EHELCC_08790 EHELCC_08790 49.1 Morganella morganii S2 chuT ABC-type hemin transport system, periplasmic component
NLDBIP_09115 NLDBIP_09115 49.1 Morganella morganii S4 chuT ABC-type hemin transport system, periplasmic component
LHKJJB_05150 LHKJJB_05150 49.1 Morganella morganii S3 chuT ABC-type hemin transport system, periplasmic component
HKOGLL_05765 HKOGLL_05765 49.1 Morganella morganii S5 chuT ABC-type hemin transport system, periplasmic component
F4V73_RS03450 F4V73_RS03450 50.4 Morganella psychrotolerans - ABC transporter substrate-binding protein

Distribution of the homologs in the orthogroup group_1792

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1792

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q56991 1.2e-106 313 55 1 268 1 hmuT Hemin-binding periplasmic protein HmuT Yersinia pestis
Q8DEM7 2.09e-18 85 27 9 259 3 btuF Vitamin B12-binding protein Vibrio vulnificus (strain CMCP6)
A7MXP0 6.16e-18 84 26 8 250 3 btuF Vitamin B12-binding protein Vibrio campbellii (strain ATCC BAA-1116)
Q7MNT2 1.31e-17 83 26 9 259 3 btuF Vitamin B12-binding protein Vibrio vulnificus (strain YJ016)
Q66EE7 4.31e-16 79 23 8 272 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K552 4.31e-16 79 23 8 272 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FM05 4.31e-16 79 23 8 272 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TPX1 5.82e-16 79 23 8 271 3 btuF Vitamin B12-binding protein Yersinia pestis (strain Pestoides F)
Q1CLU2 5.82e-16 79 23 8 271 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E1 5.82e-16 79 23 8 271 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBM3 5.82e-16 79 23 8 271 3 btuF Vitamin B12-binding protein Yersinia pestis
Q1C3X6 5.82e-16 79 23 8 271 3 btuF Vitamin B12-binding protein Yersinia pestis bv. Antiqua (strain Antiqua)
B1JK18 5.87e-16 79 23 8 271 3 btuF Vitamin B12-binding protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
C3LQF3 1.92e-14 74 26 8 233 3 btuF Vitamin B12-binding protein Vibrio cholerae serotype O1 (strain M66-2)
Q9KPI6 1.92e-14 74 26 8 233 3 btuF Vitamin B12-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5P5 1.92e-14 74 26 8 233 1 btuF Vitamin B12-binding protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87SE7 2.02e-14 74 25 8 236 3 btuF Vitamin B12-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O34805 4.22e-14 74 24 8 258 3 yvrC Uncharacterized ABC transporter substrate-binding lipoprotein YvrC Bacillus subtilis (strain 168)
Q6LUR6 5.74e-13 70 24 5 219 3 btuF Vitamin B12-binding protein Photobacterium profundum (strain SS9)
C6DC28 5.03e-12 67 24 7 229 3 btuF Vitamin B12-binding protein Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D1Z3 1.64e-11 66 23 7 232 3 btuF Vitamin B12-binding protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N842 2.18e-10 63 23 7 214 3 btuF Vitamin B12-binding protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P37028 3.5e-08 56 24 6 232 1 btuF Vitamin B12-binding protein Escherichia coli (strain K12)
Q83MD7 5.15e-08 56 24 6 232 3 btuF Vitamin B12-binding protein Shigella flexneri
Q8CWD2 7.5e-08 55 24 6 232 3 btuF Vitamin B12-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X8Z0 7.78e-08 55 23 6 232 3 btuF Vitamin B12-binding protein Escherichia coli O157:H7
Q9HQ20 0.001 43 22 5 201 1 btuF Cobalamin-binding protein Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G2 0.001 43 22 5 201 3 btuF Cobalamin-binding protein Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06910
Feature type CDS
Gene -
Product hemin ABC transporter substrate-binding protein
Location 1512792 - 1513607 (strand: 1)
Length 816 (nucleotides) / 271 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1792
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01497 Periplasmic binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4558 Inorganic ion transport and metabolism (P) P ABC-type hemin transport system, periplasmic component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K25132 heme transport system substrate-binding protein - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG044293 hemin ABC transporter substrate-binding protein VF1253 Nutritional/Metabolic factor

Protein Sequence

MKKWLLLILCSLMTFTSLAKQRIVTIGGDITEIVFALGAGDQVIARDSTSLVPEQVKSLPDVGYMRMLNPEGILSVKPTLIIASELARPSFALRRIEKAGVPVETITGTRSLEAINEKIDAIATLLQKETESQQLKEKLTQSINQIATTPIDKKIIYIMSHGGVAPMAAGQNTAADTIITLVGGKNAMQGFSSYRLLSQEGVIASQPDILLVTKEGIKGIGGIEKLWDLPGIKYTPAGKNKRYIVVDDMGLLGFTLSTPKVMQQIRQALEQ

Flanking regions ( +/- flanking 50bp)

GTGAGCAACTCAACGCTCTTGCTAAAATAGCTTAATAGAAGGATAGCTCAATGAAAAAATGGCTTCTTTTGATCCTGTGTAGTTTGATGACATTCACCAGCCTCGCTAAACAACGTATTGTCACTATTGGTGGTGATATTACTGAAATTGTTTTTGCATTAGGTGCAGGCGATCAGGTCATTGCTAGAGATAGTACGAGTTTAGTACCAGAGCAAGTTAAATCATTACCCGATGTGGGTTATATGCGCATGCTCAATCCTGAAGGTATTCTTTCGGTTAAACCGACGCTGATTATTGCTAGCGAATTAGCTCGCCCTTCTTTTGCATTACGTCGTATCGAAAAAGCAGGTGTACCTGTTGAAACTATTACGGGTACACGTTCATTAGAAGCCATTAATGAAAAAATCGATGCCATTGCAACCCTCTTACAAAAAGAAACAGAGAGTCAGCAATTAAAAGAAAAGCTCACTCAATCTATTAATCAAATTGCCACGACGCCTATTGATAAAAAAATTATTTATATCATGAGCCATGGTGGTGTTGCCCCTATGGCTGCCGGTCAAAATACTGCTGCAGATACGATTATCACACTGGTAGGCGGAAAAAATGCTATGCAAGGTTTTAGTAGTTACCGCTTACTGTCACAAGAAGGGGTTATTGCCAGCCAGCCTGATATTTTGTTGGTCACTAAAGAGGGAATAAAAGGTATTGGAGGTATCGAAAAACTGTGGGACTTGCCCGGCATAAAGTACACCCCCGCAGGTAAAAATAAGCGCTATATCGTTGTTGATGATATGGGTTTATTAGGCTTTACCTTATCAACCCCCAAAGTTATGCAACAAATTCGTCAAGCATTGGAGCAATAATGTCTCGTTTTCGCTCACCGTGGATGAGTATTGCCATTTTACTCATCTTA