Homologs in group_1034

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05830 FBDBKF_05830 62.3 Morganella morganii S1 sufA Fe-S cluster assembly scaffold SufA
EHELCC_11760 EHELCC_11760 62.3 Morganella morganii S2 sufA Fe-S cluster assembly scaffold SufA
NLDBIP_12100 NLDBIP_12100 62.3 Morganella morganii S4 sufA Fe-S cluster assembly scaffold SufA
LHKJJB_11960 LHKJJB_11960 62.3 Morganella morganii S3 sufA Fe-S cluster assembly scaffold SufA
HKOGLL_10575 HKOGLL_10575 62.3 Morganella morganii S5 sufA Fe-S cluster assembly scaffold SufA
F4V73_RS03495 F4V73_RS03495 59.0 Morganella psychrotolerans sufA Fe-S cluster assembly scaffold SufA

Distribution of the homologs in the orthogroup group_1034

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1034

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77667 5.23e-51 160 60 0 122 1 sufA Iron-sulfur cluster assembly protein SufA Escherichia coli (strain K12)
C5BEU3 2.18e-30 107 46 0 105 3 iscA Iron-binding protein IscA Edwardsiella ictaluri (strain 93-146)
A4WDA9 4.07e-30 107 44 0 105 3 iscA Iron-binding protein IscA Enterobacter sp. (strain 638)
Q8KA13 1.66e-29 106 35 1 120 3 BUsg_114 Uncharacterized protein BUsg_114 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B1JRZ0 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667Y3 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMV2 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pestis (strain Pestoides F)
Q1CKA7 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R816 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCS3 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pestis
B2K9R5 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5H2 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFX3 2.29e-29 105 43 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N226 2.5e-29 105 45 0 105 3 iscA Iron-binding protein IscA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JKQ4 1.33e-28 103 41 0 105 3 iscA Iron-binding protein IscA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GHY1 1.33e-28 103 41 0 105 3 iscA Iron-binding protein IscA Serratia proteamaculans (strain 568)
B4EZU6 1.74e-28 102 43 0 105 3 iscA Iron-binding protein IscA Proteus mirabilis (strain HI4320)
Q8GLE6 3.01e-28 102 45 0 105 3 iscA Iron-binding protein IscA Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q3YZ24 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Shigella sonnei (strain Ss046)
P0AAD1 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Shigella flexneri
Q32D36 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Shigella dysenteriae serotype 1 (strain Sd197)
Q31XW2 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Shigella boydii serotype 4 (strain Sb227)
B7LKB1 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNI4 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain SMS-3-5 / SECEC)
B6I5A0 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain SE11)
B7N6B5 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AAC8 3.43e-28 102 43 0 105 1 iscA Iron-binding protein IscA Escherichia coli (strain K12)
B1IWD3 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAC9 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEV7 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE65 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O1:K1 / APEC
B1XB03 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / DH10B)
C4ZXA3 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7N1 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O8 (strain IAI1)
B7MYG2 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O81 (strain ED1a)
B7NRH7 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AAD0 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O157:H7
B7LDC0 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain 55989 / EAEC)
B7MIL8 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGX4 3.43e-28 102 43 0 105 3 iscA Iron-binding protein IscA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5XNJ9 3.87e-28 102 42 0 105 3 iscA Iron-binding protein IscA Klebsiella pneumoniae (strain 342)
Q7CQ12 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFZ8 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella typhi
B4TRX3 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella schwarzengrund (strain CVM19633)
B5BAW8 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain AKU_12601)
C0PYK9 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi C (strain RKS4594)
A9N1X7 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNG5 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TDB4 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella heidelberg (strain SL476)
B5RD10 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5A0 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella enteritidis PT4 (strain P125109)
B5FR83 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella dublin (strain CT_02021853)
Q57LH1 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella choleraesuis (strain SC-B67)
A9MHJ6 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1B8 4e-28 102 43 0 105 3 iscA Iron-binding protein IscA Salmonella agona (strain SL483)
A6TCE9 5.85e-28 101 42 0 105 3 iscA Iron-binding protein IscA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4T0S0 3.01e-27 99 43 0 105 3 iscA Iron-binding protein IscA Salmonella newport (strain SL254)
A7MGY0 5.79e-27 99 41 0 105 3 iscA Iron-binding protein IscA Cronobacter sakazakii (strain ATCC BAA-894)
C6DBI9 1.46e-26 98 41 0 105 3 iscA Iron-binding protein IscA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D261 2.61e-26 97 41 0 105 3 iscA Iron-binding protein IscA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P44672 5.24e-26 96 41 0 106 3 iscA Iron-binding protein IscA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57222 6.91e-23 89 32 1 126 3 BU122 Uncharacterized protein BU122 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P18501 2.2e-20 82 37 0 90 3 hesB Protein HesB Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P46051 3.83e-20 82 37 0 88 2 hesB1 Protein HesB, heterocyst Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5ZJ74 1.97e-19 80 34 0 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Gallus gallus
P46052 4.03e-19 79 36 0 88 2 hesB2 Protein HesB, vegetative Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9D924 5.06e-19 79 36 0 106 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Mus musculus
Q80W96 5.7e-19 79 36 0 106 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Rattus norvegicus
Q4R5F0 7.23e-19 79 34 0 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Macaca fascicularis
Q9BUE6 7.23e-19 79 34 0 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Homo sapiens
Q3SZG8 7.23e-19 79 34 0 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Bos taurus
P0DN75 7.8e-19 79 33 0 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Columba livia
P46053 1.04e-18 78 33 2 106 3 hesB Protein HesB Leptolyngbya boryana
Q9ZD62 2.26e-18 77 37 1 106 3 RP484 Uncharacterized protein RP484 Rickettsia prowazekii (strain Madrid E)
P72731 4.47e-18 76 33 1 112 3 slr1417 Uncharacterized protein slr1417 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4QRC6 8.8e-18 76 33 0 106 2 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Danio rerio
Q47887 1.75e-17 75 36 1 106 3 None Uncharacterized protein in nifB-nifU intergenic region Frankia alni
Q8T3X9 5.34e-16 71 33 0 106 1 MagR Iron-sulfur cluster assembly 1 homolog, mitochondrial Drosophila melanogaster
Q44540 7.12e-16 70 32 1 104 3 None Uncharacterized protein in nifU 5'region Azotobacter vinelandii
Q9DCB8 8.86e-16 72 33 2 123 1 Isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Mus musculus
Q86U28 1.78e-15 70 34 2 106 1 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Homo sapiens
O67709 1.78e-15 70 33 2 113 1 aq_1857 Protein aq_1857 Aquifex aeolicus (strain VF5)
Q5R788 2.2e-15 70 34 2 106 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Pongo abelii
Q2TBG7 3.1e-15 70 34 2 117 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Bos taurus
Q8LBM4 3.56e-15 69 35 1 105 2 At2g16710 Iron-sulfur assembly protein IscA-like 1, mitochondrial Arabidopsis thaliana
Q60AU6 4.05e-15 69 32 2 117 3 erpA2 Iron-sulfur cluster insertion protein ErpA 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P37029 4.82e-15 68 36 1 105 3 blr1755 Uncharacterized protein blr1755 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8L8C0 5.78e-15 68 38 2 105 3 At2g36260 Iron-sulfur assembly protein IscA-like 3, mitochondrial Arabidopsis thaliana
Q6FG12 6.14e-15 68 35 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q89AW2 1.01e-14 68 35 2 107 3 bbp_116 Uncharacterized protein bbp_116 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q54VS1 1.13e-14 68 36 2 104 3 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Dictyostelium discoideum
Q07821 1.29e-14 70 35 1 105 1 ISA1 Iron-sulfur assembly protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q31IS8 1.42e-14 67 35 2 105 3 erpA Iron-sulfur cluster insertion protein ErpA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q53211 2.01e-14 67 34 1 105 3 NGR_a01210 Uncharacterized protein y4vC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2YBK7 2.7e-14 67 33 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8Y242 2.93e-14 67 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1AXV9 4.03e-14 66 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Ruthia magnifica subsp. Calyptogena magnifica
B2UFK5 4.09e-14 66 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia pickettii (strain 12J)
O32113 4.24e-14 66 31 1 104 3 sufA Uncharacterized protein SufA Bacillus subtilis (strain 168)
Q5P7U0 4.34e-14 66 37 4 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9MSA1 5.39e-14 66 33 2 106 3 ycf83 Uncharacterized protein ycf83 Galdieria sulphuraria
A4T031 5.9e-14 66 34 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A9I246 6.07e-14 66 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
P78859 7.13e-14 67 33 1 106 2 isa1 Iron-sulfur assembly protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q0AFU6 7.6e-14 65 33 2 121 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0VSN8 7.99e-14 65 36 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
P46045 8.74e-14 67 35 1 97 3 nifU Nitrogen fixation protein NifU Frankia alni
A1WL78 1.04e-13 65 34 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Verminephrobacter eiseniae (strain EF01-2)
A1TYH3 1.05e-13 65 34 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A2SKL7 1.72e-13 65 35 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q82UQ4 1.82e-13 65 35 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B0U4D9 2e-13 65 33 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M12)
Q9XIK3 2.02e-13 66 31 1 107 2 ISCA Iron-sulfur assembly protein IscA, chloroplastic Arabidopsis thaliana
P74596 2.32e-13 64 31 1 105 1 slr1565 Uncharacterized protein slr1565 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B0VAE9 2.54e-13 64 35 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AYE)
A3M0R4 2.54e-13 64 35 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I2I7 2.54e-13 64 35 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ACICU)
B7IAZ8 2.54e-13 64 35 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB0057)
B7GUY5 2.54e-13 64 35 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB307-0294)
A1TUF2 2.62e-13 64 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paracidovorax citrulli (strain AAC00-1)
A4JBK6 2.63e-13 64 33 2 107 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B0VML0 2.65e-13 64 35 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain SDF)
B0TZ08 2.8e-13 64 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0ABJ8 3.25e-13 64 33 2 110 3 erpA Iron-sulfur cluster insertion protein ErpA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1W3Q0 3.67e-13 64 32 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Acidovorax sp. (strain JS42)
Q2S8Y5 4.36e-13 63 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Hahella chejuensis (strain KCTC 2396)
A9AH79 4.69e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia multivorans (strain ATCC 17616 / 249)
Q2KV08 5.28e-13 63 33 2 124 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella avium (strain 197N)
Q39JJ8 5.4e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B0UU19 5.66e-13 63 36 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 2336)
Q0I3N9 5.66e-13 63 36 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 129Pt)
Q0BI89 5.69e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTD3 5.69e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain MC40-6)
Q1BZ43 6.2e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain AU 1054)
B1JVU6 6.2e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain MC0-3)
B4EET4 6.2e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K7 6.2e-13 63 33 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain HI2424)
Q2NVP9 7.19e-13 63 35 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Sodalis glossinidius (strain morsitans)
A4IZA5 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGX6 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BKU2 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain OSU18)
A0Q5J0 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. novicida (strain U112)
B2SDK6 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A270 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain LVS)
A7NDP2 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14IC8 7.45e-13 63 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain FSC 198)
B2FJT4 7.5e-13 63 34 2 105 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain K279a)
B2JGV0 9.72e-13 63 32 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2SZ67 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW5 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain K96243)
A3NDG6 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 668)
Q3JNR3 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1710b)
A3NZ78 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1106a)
A1V053 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain SAVP1)
Q62HB8 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain ATCC 23344)
A2S583 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10229)
A3MP61 1e-12 63 34 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10247)
P64343 1.14e-12 63 33 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P64342 1.14e-12 63 33 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain 9a5c)
B2I891 1.14e-12 63 33 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M23)
A1ST94 1.16e-12 62 35 2 105 3 erpA Iron-sulfur cluster insertion protein ErpA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1QES5 1.24e-12 63 36 3 105 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FVP8 1.24e-12 63 36 3 105 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1LRC6 1.56e-12 62 32 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A5CVH1 2.01e-12 62 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q12KD2 2.05e-12 62 36 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q7VUW2 2.09e-12 62 32 2 124 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z5 2.09e-12 62 32 2 124 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC7 2.09e-12 62 32 2 124 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A6SUP2 2.16e-12 62 32 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Janthinobacterium sp. (strain Marseille)
B0BR51 2.37e-12 62 36 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B2AH60 2.45e-12 62 32 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q475T0 2.45e-12 62 32 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KED6 2.45e-12 62 32 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1K969 2.51e-12 62 34 4 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Azoarcus sp. (strain BH72)
A9C177 2.79e-12 62 32 2 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Delftia acidovorans (strain DSM 14801 / SPH-1)
Q8LCY2 3e-12 62 33 1 104 1 At5g03905 Iron-sulfur assembly protein IscA-like 2, mitochondrial Arabidopsis thaliana
Q65SZ6 3.03e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8PD57 3.08e-12 62 30 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN15 3.08e-12 62 30 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain B100)
Q4UZE2 3.08e-12 62 30 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain 8004)
Q220S8 3.37e-12 61 32 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B2SYK8 3.45e-12 61 31 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13UB4 3.45e-12 61 31 1 106 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Paraburkholderia xenovorans (strain LB400)
Q124P0 3.92e-12 61 32 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polaromonas sp. (strain JS666 / ATCC BAA-500)
B8F870 4.42e-12 61 35 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Glaesserella parasuis serovar 5 (strain SH0165)
Q01195 5.02e-12 60 33 3 106 3 None Uncharacterized protein in nifU 5'region Cereibacter sphaeroides
B4SLD1 5.44e-12 61 32 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain R551-3)
Q88QQ5 5.74e-12 60 33 4 121 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B3H296 6.23e-12 60 36 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9CNH3 7.02e-12 60 34 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Pasteurella multocida (strain Pm70)
A4G1T7 7.59e-12 60 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Herminiimonas arsenicoxydans
A4SJ82 7.92e-12 60 35 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas salmonicida (strain A449)
A0KNY6 9.3e-12 60 35 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3SF18 9.92e-12 60 35 4 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Thiobacillus denitrificans (strain ATCC 25259)
Q6D1Z1 1.03e-11 60 34 4 115 3 erpA Iron-sulfur cluster insertion protein ErpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7MHZ0 1.11e-11 60 36 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain YJ016)
Q9ZE83 1.22e-11 60 30 2 108 3 RP063 Uncharacterized protein RP063 Rickettsia prowazekii (strain Madrid E)
Q3BY98 1.25e-11 60 31 1 101 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8DBX7 1.36e-11 60 36 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain CMCP6)
Q8PQ32 1.42e-11 60 31 1 101 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas axonopodis pv. citri (strain 306)
A3N2B0 1.57e-11 59 35 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C3LSN2 1.64e-11 59 38 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain M66-2)
Q9KU96 1.64e-11 59 38 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F947 1.64e-11 59 38 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q6LUS1 1.8e-11 59 35 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Photobacterium profundum (strain SS9)
C1DHX9 1.81e-11 59 33 5 122 3 erpA Iron-sulfur cluster insertion protein ErpA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q493N7 1.89e-11 59 35 4 118 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella pennsylvanica (strain BPEN)
A5UFF5 1.95e-11 59 32 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittGG)
Q4QJM4 1.95e-11 59 32 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain 86-028NP)
Q47IC1 1.99e-11 59 32 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Dechloromonas aromatica (strain RCB)
A6VN49 2.03e-11 59 34 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P45344 2.1e-11 59 33 4 108 1 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBF7 2.12e-11 59 33 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittEE)
Q5H5J1 2.67e-11 59 31 1 101 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P884 2.67e-11 59 31 1 101 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1KSG6 2.71e-11 59 30 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDN1 2.71e-11 59 30 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IQG0 2.71e-11 59 30 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F6W8 2.71e-11 59 30 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P0A5B0 3.92e-11 58 29 1 106 1 BQ2027_MB2227C Protein Mb2227c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMN5 3.92e-11 58 29 1 106 1 Rv2204c Protein Rv2204c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMN4 3.92e-11 58 29 1 106 3 MT2260 Protein MT2260 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9X4A0 4.17e-11 58 35 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0A146B130 4.43e-11 59 38 4 114 2 SufA Iron-sulfur cluster assembly protein SufA Plasmodium vivax
A1VMK3 6.29e-11 58 32 4 122 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Polaromonas naphthalenivorans (strain CJ2)
Q1GXC7 6.91e-11 58 28 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7VQH5 8.21e-11 58 35 3 110 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella floridana
Q1QSB5 8.29e-11 58 34 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q87LY4 8.91e-11 57 34 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B2VE26 9.02e-11 57 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3K5W6 9.22e-11 57 33 5 121 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain Pf0-1)
A7MGR3 9.61e-11 57 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Cronobacter sakazakii (strain ATCC BAA-894)
B4RWS2 9.93e-11 57 33 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B4EUE2 1.05e-10 57 31 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Proteus mirabilis (strain HI4320)
A4W6Q3 1.08e-10 57 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Enterobacter sp. (strain 638)
Q43895 1.19e-10 57 34 2 105 3 None Uncharacterized protein in nifU 5'region Azospirillum brasilense
Q4K514 1.39e-10 57 33 5 121 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A8ALD2 1.49e-10 57 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7N843 1.73e-10 57 35 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4XZB1 1.79e-10 57 34 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas mendocina (strain ymp)
B6EL03 2.01e-10 57 31 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio salmonicida (strain LFI1238)
C5BAP7 2.06e-10 57 34 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Edwardsiella ictaluri (strain 93-146)
Q13N17 2.15e-10 57 33 4 106 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Paraburkholderia xenovorans (strain LB400)
Q9I5Q6 2.19e-10 57 31 5 122 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TA1 2.19e-10 57 31 5 122 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V623 2.19e-10 57 31 5 122 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain LESB58)
A6UZG6 2.19e-10 57 31 5 122 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain PA7)
B8D7B5 2.22e-10 57 30 2 105 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D910 2.22e-10 57 30 2 105 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q54P40 2.53e-10 58 29 4 123 3 isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Dictyostelium discoideum
A1JJQ3 2.8e-10 56 31 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4VHK9 2.84e-10 56 34 6 122 3 erpA Iron-sulfur cluster insertion protein ErpA Stutzerimonas stutzeri (strain A1501)
B5FAL7 3.12e-10 56 34 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain MJ11)
Q5E2W7 3.12e-10 56 34 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MUU6 3.4e-10 56 35 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio campbellii (strain ATCC BAA-1116)
Q7CR66 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFF3 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhi
B4TXQ8 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella schwarzengrund (strain CVM19633)
A9N0Q2 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD49 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUY6 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella newport (strain SL254)
B4TK32 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella heidelberg (strain SL476)
B5RHE2 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3G8 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella enteritidis PT4 (strain P125109)
B5FJ03 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella dublin (strain CT_02021853)
Q57T51 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella choleraesuis (strain SC-B67)
A9MPK5 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8R7 3.4e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella agona (strain SL483)
B1JK20 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EE9 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPW8 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis (strain Pestoides F)
Q1CLU5 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E3 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Angola)
Q0WBQ9 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis
B2K550 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3X3 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM07 3.59e-10 56 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q07YU9 3.63e-10 56 33 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella frigidimarina (strain NCIMB 400)
Q3Z5K1 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella sonnei (strain Ss046)
P0ACC6 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri
Q0T850 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri serotype 5b (strain 8401)
Q32JV2 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella dysenteriae serotype 1 (strain Sd197)
Q325Y3 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 4 (strain Sb227)
B2U301 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWB7 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RG32 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain UTI89 / UPEC)
B1LGV9 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SMS-3-5 / SECEC)
B6HZD2 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SE11)
B7N825 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACC3 3.66e-10 56 32 4 116 1 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12)
B1IQI4 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ACC4 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLH5 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K2 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O1:K1 / APEC
A7ZWA4 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O9:H4 (strain HS)
B1XD26 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / DH10B)
C4ZRP9 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M197 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O8 (strain IAI1)
B7MP18 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O81 (strain ED1a)
B7NIB9 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0D6 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACC5 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7
B7LGL8 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain 55989 / EAEC)
B7MBD9 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIK3 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHP8 3.66e-10 56 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O139:H28 (strain E24377A / ETEC)
C3K2Z6 4.4e-10 56 33 5 121 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain SBW25)
Q47VA3 4.84e-10 55 29 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P57307 5.21e-10 55 30 2 105 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q21MI1 5.87e-10 55 32 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B5Y1L3 6.39e-10 55 30 2 115 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae (strain 342)
Q5QVQ4 6.67e-10 55 34 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3IHQ0 7.03e-10 55 36 6 110 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas translucida (strain TAC 125)
A4JRL3 7.97e-10 55 33 4 106 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1IFY7 8.99e-10 55 33 5 121 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas entomophila (strain L48)
O43045 9.13e-10 57 28 2 107 3 isa2 Iron-sulfur assembly protein 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A6T4W0 1.04e-09 55 30 2 115 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8H175 1.08e-09 55 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8G9U9 1.08e-09 55 31 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Serratia proteamaculans (strain 568)
A3QBP0 1.27e-09 55 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EHC4 1.39e-09 54 32 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q4ZMM4 1.44e-09 54 32 3 105 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. syringae (strain B728a)
Q889Z2 1.44e-09 54 32 3 105 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NN6 1.44e-09 54 32 3 105 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B7VJJ4 1.48e-09 55 33 4 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio atlanticus (strain LGP32)
Q0HSF0 1.52e-09 54 32 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-7)
Q0HG57 1.52e-09 54 32 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-4)
A0KZS2 1.52e-09 54 32 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain ANA-3)
A1RMG3 1.58e-09 54 32 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain W3-18-1)
A4Y4G8 1.58e-09 54 32 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
C4K3H0 1.88e-09 54 30 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0TIR0 2.04e-09 54 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella halifaxensis (strain HAW-EB4)
Q7NRT6 2.75e-09 54 30 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B8CQR0 3.68e-09 53 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella piezotolerans (strain WP3 / JCM 13877)
A1WVE3 7.29e-09 53 28 1 108 3 erpA Iron-sulfur cluster insertion protein ErpA Halorhodospira halophila (strain DSM 244 / SL1)
A9L5J9 1.28e-08 52 32 3 113 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS195)
A6WKM0 1.28e-08 52 32 3 113 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS185)
A3D1R9 1.28e-08 52 32 3 113 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBT9 1.28e-08 52 32 3 113 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS223)
Q1LTN5 1.28e-08 52 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3JC94 1.32e-08 52 27 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q15YG5 1.38e-08 52 33 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A0A509ANY8 1.99e-08 52 32 3 110 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium berghei (strain Anka)
Q5WWW0 2.12e-08 52 27 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Lens)
Q07184 2.14e-08 51 33 2 83 3 None Uncharacterized protein in nifU 5'region Rhodobacter capsulatus
B5EQH0 2.24e-08 52 29 3 122 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JAH6 2.24e-08 52 29 3 122 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q5ZVQ2 2.43e-08 52 27 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBN0 3.71e-08 51 26 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Corby)
Q5X5H7 3.79e-08 51 26 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Paris)
A9KB96 8.7e-08 50 28 2 119 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain Dugway 5J108-111)
Q83AK7 2.34e-07 49 27 2 119 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAW9 2.34e-07 49 27 2 119 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 331 / Henzerling II)
O51930 8.62e-07 47 29 0 82 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1S3U4 1.06e-06 47 28 0 90 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q8I3N6 1.32e-06 48 30 3 110 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium falciparum (isolate 3D7)
P51217 3.58e-06 45 32 3 106 3 ycf83 Uncharacterized protein ycf83 Porphyra purpurea
Q89AQ6 4.79e-06 45 26 2 123 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1VJJ5 5.16e-06 45 29 2 96 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Polaromonas naphthalenivorans (strain CJ2)
Q60C62 6.38e-05 42 32 6 100 3 erpA1 Iron-sulfur cluster insertion protein ErpA 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8D3C7 0.000121 42 28 0 82 3 erpA Iron-sulfur cluster insertion protein ErpA Wigglesworthia glossinidia brevipalpis
Q1XDR9 0.000394 40 27 1 105 3 ycf83 Uncharacterized protein ycf83 Neopyropia yezoensis
Q057T9 0.000818 39 28 0 78 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B0BS54 0.000819 40 25 2 98 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZZ1 0.000819 40 25 2 98 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYM1 0.000819 40 25 2 98 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A3Q930 0.001 40 26 2 98 3 nfuA Fe/S biogenesis protein NfuA Shewanella loihica (strain ATCC BAA-1088 / PV-4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06850
Feature type CDS
Gene sufA
Product Fe-S cluster assembly scaffold SufA
Location 1495403 - 1495771 (strand: -1)
Length 369 (nucleotides) / 122 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1034
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01521 Iron-sulphur cluster biosynthesis

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0316 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly iron-binding protein IscA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05997 Fe-S cluster assembly protein SufA - -

Protein Sequence

MTNNVETFSLNDTAWQGIVLTDSAAKHICQLVEKNPESQGLSLSIKPSGCTGYGYVIELAAGPSEDDLVYEHNGAKLFVALKAMPFIDGLVVDYVREGLNQMFKFNNPKAQNVCGCGESFGV

Flanking regions ( +/- flanking 50bp)

ACCATTAGAGTCAGGAAAGATATTAATCTCCTTTCGAAATGAGGTCAGTAATGACAAACAATGTTGAAACTTTTTCTCTAAATGATACTGCTTGGCAAGGCATTGTGCTGACTGATAGTGCAGCGAAACATATTTGCCAATTAGTGGAGAAAAACCCTGAAAGTCAGGGACTTTCCTTAAGTATTAAGCCATCAGGTTGTACGGGCTATGGTTATGTTATTGAGCTTGCTGCAGGCCCCTCAGAGGACGATCTTGTCTATGAACATAATGGTGCCAAGTTATTCGTTGCATTAAAAGCCATGCCATTCATTGATGGTTTAGTTGTTGATTATGTCCGTGAAGGACTTAATCAGATGTTTAAATTTAATAATCCTAAAGCTCAGAACGTCTGCGGATGTGGTGAGAGCTTTGGGGTATAACATAGTGAAGTCAGATTATGTCTCAGAGCAATGTTGAAATTGGTGATGAA