Homologs in group_1101

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05830 FBDBKF_05830 100.0 Morganella morganii S1 sufA Fe-S cluster assembly scaffold SufA
NLDBIP_12100 NLDBIP_12100 100.0 Morganella morganii S4 sufA Fe-S cluster assembly scaffold SufA
LHKJJB_11960 LHKJJB_11960 100.0 Morganella morganii S3 sufA Fe-S cluster assembly scaffold SufA
HKOGLL_10575 HKOGLL_10575 100.0 Morganella morganii S5 sufA Fe-S cluster assembly scaffold SufA
F4V73_RS03495 F4V73_RS03495 93.7 Morganella psychrotolerans sufA Fe-S cluster assembly scaffold SufA
PMI_RS06850 PMI_RS06850 62.3 Proteus mirabilis HI4320 sufA Fe-S cluster assembly scaffold SufA

Distribution of the homologs in the orthogroup group_1101

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1101

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77667 6.55e-52 162 64 0 116 1 sufA Iron-sulfur cluster assembly protein SufA Escherichia coli (strain K12)
C5BEU3 4.73e-33 114 47 0 105 3 iscA Iron-binding protein IscA Edwardsiella ictaluri (strain 93-146)
Q8GLE6 3.61e-32 112 48 0 105 3 iscA Iron-binding protein IscA Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
A8GHY1 9.98e-32 111 44 0 105 3 iscA Iron-binding protein IscA Serratia proteamaculans (strain 568)
P44672 1.21e-31 111 46 0 106 3 iscA Iron-binding protein IscA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7CQ12 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFZ8 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella typhi
B4TRX3 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella schwarzengrund (strain CVM19633)
B5BAW8 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain AKU_12601)
C0PYK9 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi C (strain RKS4594)
A9N1X7 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNG5 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TDB4 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella heidelberg (strain SL476)
B5RD10 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5A0 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella enteritidis PT4 (strain P125109)
B5FR83 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella dublin (strain CT_02021853)
Q57LH1 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella choleraesuis (strain SC-B67)
A9MHJ6 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1B8 1.88e-31 110 47 0 105 3 iscA Iron-binding protein IscA Salmonella agona (strain SL483)
A1JKQ4 2.55e-31 110 42 0 105 3 iscA Iron-binding protein IscA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JRZ0 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667Y3 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMV2 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pestis (strain Pestoides F)
Q1CKA7 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R816 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCS3 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pestis
B2K9R5 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5H2 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFX3 6.75e-31 109 42 0 105 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3YZ24 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Shigella sonnei (strain Ss046)
P0AAD1 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Shigella flexneri
Q32D36 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Shigella dysenteriae serotype 1 (strain Sd197)
Q31XW2 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Shigella boydii serotype 4 (strain Sb227)
B7LKB1 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNI4 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain SMS-3-5 / SECEC)
B6I5A0 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain SE11)
B7N6B5 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AAC8 9.26e-31 108 46 0 105 1 iscA Iron-binding protein IscA Escherichia coli (strain K12)
B1IWD3 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAC9 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEV7 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE65 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O1:K1 / APEC
B1XB03 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / DH10B)
C4ZXA3 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7N1 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O8 (strain IAI1)
B7MYG2 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O81 (strain ED1a)
B7NRH7 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AAD0 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O157:H7
B7LDC0 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli (strain 55989 / EAEC)
B7MIL8 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGX4 9.26e-31 108 46 0 105 3 iscA Iron-binding protein IscA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5XNJ9 9.57e-31 108 45 0 105 3 iscA Iron-binding protein IscA Klebsiella pneumoniae (strain 342)
B4EZU6 1.14e-30 108 47 0 105 3 iscA Iron-binding protein IscA Proteus mirabilis (strain HI4320)
Q7N226 1.24e-30 108 44 0 105 3 iscA Iron-binding protein IscA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TCE9 1.9e-30 108 45 0 105 3 iscA Iron-binding protein IscA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4T0S0 2.88e-30 107 46 0 105 3 iscA Iron-binding protein IscA Salmonella newport (strain SL254)
C6DBI9 4.37e-30 107 44 0 105 3 iscA Iron-binding protein IscA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D261 8.32e-30 106 44 0 105 3 iscA Iron-binding protein IscA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4WDA9 9.48e-30 106 43 0 105 3 iscA Iron-binding protein IscA Enterobacter sp. (strain 638)
A7MGY0 1.44e-28 103 44 0 105 3 iscA Iron-binding protein IscA Cronobacter sakazakii (strain ATCC BAA-894)
Q8KA13 1.65e-27 101 35 1 120 3 BUsg_114 Uncharacterized protein BUsg_114 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57222 4.15e-27 100 37 1 126 3 BU122 Uncharacterized protein BU122 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8T3X9 7.44e-25 94 41 0 106 1 MagR Iron-sulfur cluster assembly 1 homolog, mitochondrial Drosophila melanogaster
P0DN75 2.3e-22 88 36 0 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Columba livia
Q5ZJ74 2.53e-22 88 36 0 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Gallus gallus
Q80W96 2.73e-22 88 39 2 107 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Rattus norvegicus
Q4QRC6 3.07e-22 87 37 0 106 2 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Danio rerio
Q9D924 3.78e-22 87 38 0 106 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Mus musculus
Q4R5F0 6.57e-22 87 36 0 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Macaca fascicularis
Q9BUE6 6.57e-22 87 36 0 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Homo sapiens
Q3SZG8 6.57e-22 87 36 0 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Bos taurus
P46052 3.1e-18 77 36 1 108 2 hesB2 Protein HesB, vegetative Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9ZD62 7.22e-18 76 36 1 106 3 RP484 Uncharacterized protein RP484 Rickettsia prowazekii (strain Madrid E)
P72731 1.89e-17 75 35 1 108 3 slr1417 Uncharacterized protein slr1417 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P18501 1.63e-16 73 31 1 110 3 hesB Protein HesB Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P46053 2.64e-16 72 32 1 106 3 hesB Protein HesB Leptolyngbya boryana
Q9DCB8 2.73e-16 73 39 1 93 1 Isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Mus musculus
P46051 3.23e-16 72 31 1 108 2 hesB1 Protein HesB, heterocyst Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q86U28 3.64e-16 72 37 1 96 1 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Homo sapiens
Q2TBG7 4.23e-16 72 38 1 96 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Bos taurus
Q5R788 4.71e-16 72 37 1 96 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Pongo abelii
Q8LBM4 6.94e-16 71 38 1 103 2 At2g16710 Iron-sulfur assembly protein IscA-like 1, mitochondrial Arabidopsis thaliana
Q89AW2 3.11e-15 70 33 3 127 3 bbp_116 Uncharacterized protein bbp_116 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2S8Y5 3.48e-15 69 37 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Hahella chejuensis (strain KCTC 2396)
Q44540 3.52e-15 69 34 1 104 3 None Uncharacterized protein in nifU 5'region Azotobacter vinelandii
A4IZA5 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGX6 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BKU2 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain OSU18)
A0Q5J0 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. novicida (strain U112)
B2SDK6 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A270 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain LVS)
A7NDP2 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14IC8 4.69e-15 68 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain FSC 198)
Q54VS1 7.32e-15 69 34 3 106 3 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Dictyostelium discoideum
Q07821 1.1e-14 70 34 1 105 1 ISA1 Iron-sulfur assembly protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P78859 1.25e-14 69 40 0 81 2 isa1 Iron-sulfur assembly protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B0TZ08 1.75e-14 67 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q47887 2.32e-14 67 33 1 106 3 None Uncharacterized protein in nifB-nifU intergenic region Frankia alni
Q0ABJ8 1.22e-13 65 30 2 126 3 erpA Iron-sulfur cluster insertion protein ErpA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9MSA1 2.85e-13 64 29 2 106 3 ycf83 Uncharacterized protein ycf83 Galdieria sulphuraria
Q53211 3.27e-13 63 34 1 105 3 NGR_a01210 Uncharacterized protein y4vC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B0U4D9 4.54e-13 64 32 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M12)
Q8L8C0 5.64e-13 63 36 2 103 3 At2g36260 Iron-sulfur assembly protein IscA-like 3, mitochondrial Arabidopsis thaliana
Q9ZE83 5.71e-13 63 32 2 108 3 RP063 Uncharacterized protein RP063 Rickettsia prowazekii (strain Madrid E)
Q4K514 6.51e-13 63 34 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
O32113 7.95e-13 63 31 1 104 3 sufA Uncharacterized protein SufA Bacillus subtilis (strain 168)
Q31IS8 9.32e-13 63 29 1 108 3 erpA Iron-sulfur cluster insertion protein ErpA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P64343 9.73e-13 63 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P64342 9.73e-13 63 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain 9a5c)
B2I891 9.73e-13 63 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M23)
Q0I3N9 1.58e-12 62 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 129Pt)
B0UU19 1.7e-12 62 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 2336)
Q88QQ5 1.75e-12 62 34 4 120 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1VMK3 1.75e-12 62 36 2 103 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Polaromonas naphthalenivorans (strain CJ2)
Q0VSN8 1.77e-12 62 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1IFY7 2.14e-12 62 34 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas entomophila (strain L48)
A4W6Q3 2.21e-12 62 31 2 115 3 erpA Iron-sulfur cluster insertion protein ErpA Enterobacter sp. (strain 638)
A8H175 2.24e-12 62 33 1 110 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8ALD2 2.59e-12 62 29 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
O67709 2.6e-12 62 31 1 102 1 aq_1857 Protein aq_1857 Aquifex aeolicus (strain VF5)
Q9XIK3 2.76e-12 63 32 1 105 2 ISCA Iron-sulfur assembly protein IscA, chloroplastic Arabidopsis thaliana
A1JJQ3 2.86e-12 62 32 3 115 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q4ZMM4 2.89e-12 62 34 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. syringae (strain B728a)
Q889Z2 2.89e-12 62 34 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NN6 2.89e-12 62 34 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A3QBP0 2.93e-12 62 33 1 110 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P0A5B0 3.13e-12 62 35 1 105 1 BQ2027_MB2227C Protein Mb2227c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMN5 3.13e-12 62 35 1 105 1 Rv2204c Protein Rv2204c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMN4 3.13e-12 62 35 1 105 3 MT2260 Protein MT2260 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P37029 3.13e-12 61 31 1 105 3 blr1755 Uncharacterized protein blr1755 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B1JK20 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EE9 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPW8 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis (strain Pestoides F)
Q1CLU5 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E3 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Angola)
Q0WBQ9 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis
B2K550 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3X3 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM07 3.14e-12 61 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q12KD2 3.29e-12 61 33 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1QES5 3.4e-12 62 34 3 111 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FVP8 3.4e-12 62 34 3 111 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
C1DHX9 3.44e-12 61 35 4 120 3 erpA Iron-sulfur cluster insertion protein ErpA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B8CQR0 3.87e-12 61 33 1 110 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella piezotolerans (strain WP3 / JCM 13877)
Q3K5W6 3.99e-12 61 33 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain Pf0-1)
Q9I5Q6 3.99e-12 61 34 4 120 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TA1 3.99e-12 61 34 4 120 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V623 3.99e-12 61 34 4 120 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain LESB58)
A6UZG6 3.99e-12 61 34 4 120 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain PA7)
B0TIR0 4.17e-12 61 33 1 110 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella halifaxensis (strain HAW-EB4)
Q60AU6 4.36e-12 62 30 1 106 3 erpA2 Iron-sulfur cluster insertion protein ErpA 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5UFF5 4.39e-12 61 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittGG)
Q4QJM4 4.39e-12 61 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain 86-028NP)
A5UBF7 4.63e-12 61 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittEE)
P45344 4.88e-12 61 31 3 107 1 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C3K2Z6 5.81e-12 61 33 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain SBW25)
A7MGR3 6.52e-12 60 29 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Cronobacter sakazakii (strain ATCC BAA-894)
P46045 7.35e-12 62 32 1 97 3 nifU Nitrogen fixation protein NifU Frankia alni
Q01195 7.64e-12 60 31 1 104 3 None Uncharacterized protein in nifU 5'region Cereibacter sphaeroides
B2VE26 7.91e-12 60 31 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q13N17 8.71e-12 60 34 3 107 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Paraburkholderia xenovorans (strain LB400)
Q65SZ6 1.14e-11 60 30 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0AFU6 1.15e-11 60 32 3 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8LCY2 1.2e-11 61 30 1 106 1 At5g03905 Iron-sulfur assembly protein IscA-like 2, mitochondrial Arabidopsis thaliana
P51217 1.2e-11 60 35 1 105 3 ycf83 Uncharacterized protein ycf83 Porphyra purpurea
O43045 1.42e-11 62 32 2 102 3 isa2 Iron-sulfur assembly protein 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3BY98 1.54e-11 60 30 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PQ32 1.55e-11 60 30 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas axonopodis pv. citri (strain 306)
Q7CR66 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFF3 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhi
B4TXQ8 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella schwarzengrund (strain CVM19633)
A9N0Q2 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD49 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUY6 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella newport (strain SL254)
B4TK32 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella heidelberg (strain SL476)
B5RHE2 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3G8 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella enteritidis PT4 (strain P125109)
B5FJ03 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella dublin (strain CT_02021853)
Q57T51 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella choleraesuis (strain SC-B67)
A9MPK5 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8R7 1.69e-11 60 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella agona (strain SL483)
Q1XDR9 1.85e-11 59 33 1 105 3 ycf83 Uncharacterized protein ycf83 Neopyropia yezoensis
Q3Z5K1 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella sonnei (strain Ss046)
P0ACC6 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri
Q0T850 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri serotype 5b (strain 8401)
Q32JV2 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella dysenteriae serotype 1 (strain Sd197)
Q325Y3 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 4 (strain Sb227)
B2U301 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWB7 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RG32 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain UTI89 / UPEC)
B1LGV9 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SMS-3-5 / SECEC)
B6HZD2 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SE11)
B7N825 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACC3 1.87e-11 59 28 1 114 1 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12)
B1IQI4 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ACC4 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLH5 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K2 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O1:K1 / APEC
A7ZWA4 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O9:H4 (strain HS)
B1XD26 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / DH10B)
C4ZRP9 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M197 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O8 (strain IAI1)
B7MP18 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O81 (strain ED1a)
B7NIB9 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0D6 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACC5 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7
B7LGL8 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain 55989 / EAEC)
B7MBD9 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIK3 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHP8 1.87e-11 59 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8PD57 2.19e-11 60 32 0 101 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN15 2.19e-11 60 32 0 101 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain B100)
Q4UZE2 2.19e-11 60 32 0 101 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain 8004)
A6T4W0 2.19e-11 59 29 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B0BR51 2.26e-11 59 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q47VA3 2.31e-11 59 29 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A8G9U9 2.34e-11 59 32 4 116 3 erpA Iron-sulfur cluster insertion protein ErpA Serratia proteamaculans (strain 568)
Q9X4A0 2.72e-11 59 31 3 115 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A4T031 2.88e-11 59 32 0 98 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B5Y1L3 3.02e-11 59 29 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae (strain 342)
C5BAP7 3.02e-11 59 32 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Edwardsiella ictaluri (strain 93-146)
A4VHK9 3.06e-11 59 33 3 109 3 erpA Iron-sulfur cluster insertion protein ErpA Stutzerimonas stutzeri (strain A1501)
A4XZB1 3.06e-11 59 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas mendocina (strain ymp)
Q82UQ4 3.31e-11 59 29 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5H5J1 3.77e-11 59 30 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P884 3.77e-11 59 30 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B4RWS2 4.17e-11 58 34 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A1TYH3 4.28e-11 58 33 4 102 3 erpA Iron-sulfur cluster insertion protein ErpA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B2FJT4 4.97e-11 58 29 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain K279a)
B5FAL7 5.05e-11 58 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain MJ11)
Q5E2W7 5.05e-11 58 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6D1Z1 6.83e-11 58 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4JBK6 6.92e-11 58 30 2 105 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q7N843 1.17e-10 57 28 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q39JJ8 1.17e-10 57 30 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A9AH79 1.39e-10 57 30 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BI89 1.42e-10 57 30 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTD3 1.42e-10 57 30 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain MC40-6)
A0A146B130 1.56e-10 58 36 4 119 2 SufA Iron-sulfur cluster assembly protein SufA Plasmodium vivax
B4SLD1 1.66e-10 57 28 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain R551-3)
Q1BZ43 1.73e-10 57 30 2 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain AU 1054)
B1JVU6 1.73e-10 57 30 2 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain MC0-3)
B4EET4 1.73e-10 57 30 2 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K7 1.73e-10 57 30 2 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain HI2424)
Q5P7U0 1.75e-10 57 32 3 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B3H296 1.8e-10 57 32 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q8EHC4 1.91e-10 57 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9CNH3 2.01e-10 57 28 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pasteurella multocida (strain Pm70)
A1AXV9 2.14e-10 57 30 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Ruthia magnifica subsp. Calyptogena magnifica
Q0HSF0 2.17e-10 57 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-7)
Q0HG57 2.17e-10 57 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-4)
A0KZS2 2.17e-10 57 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain ANA-3)
B6EL03 2.28e-10 57 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio salmonicida (strain LFI1238)
A6VN49 2.28e-10 57 28 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q2YBK7 2.41e-10 57 29 1 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1RMG3 2.46e-10 57 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain W3-18-1)
A4Y4G8 2.46e-10 57 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q54P40 2.62e-10 58 28 2 106 3 isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Dictyostelium discoideum
Q2KV08 2.65e-10 57 28 2 119 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella avium (strain 197N)
Q3SF18 2.74e-10 57 33 4 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Thiobacillus denitrificans (strain ATCC 25259)
A9I246 2.74e-10 57 29 0 117 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q15YG5 3.36e-10 56 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q2SZ67 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW5 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain K96243)
A3NDG6 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 668)
Q3JNR3 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1710b)
A3NZ78 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1106a)
A1V053 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain SAVP1)
Q62HB8 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain ATCC 23344)
A2S583 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10229)
A3MP61 3.58e-10 56 31 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10247)
Q5ZVQ2 3.84e-10 56 26 2 114 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WWW0 4.13e-10 56 25 2 114 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Lens)
Q07YU9 4.29e-10 56 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella frigidimarina (strain NCIMB 400)
A0KNY6 4.29e-10 56 30 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A5IBN0 4.31e-10 56 25 2 114 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Corby)
Q21MI1 4.34e-10 56 33 3 106 3 erpA Iron-sulfur cluster insertion protein ErpA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A3N2B0 4.43e-10 56 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q5X5H7 4.64e-10 56 25 2 114 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Paris)
Q1QSB5 4.83e-10 56 35 3 105 3 erpA Iron-sulfur cluster insertion protein ErpA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1KSG6 5.54e-10 55 29 2 112 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDN1 5.54e-10 55 29 2 112 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IQG0 5.54e-10 55 29 2 112 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F6W8 5.54e-10 55 29 2 112 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9L5J9 5.66e-10 55 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS195)
A6WKM0 5.66e-10 55 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS185)
A3D1R9 5.66e-10 55 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBT9 5.66e-10 55 32 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS223)
A1K969 5.97e-10 55 31 3 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Azoarcus sp. (strain BH72)
A1W3Q0 6.42e-10 56 29 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Acidovorax sp. (strain JS42)
Q2NVP9 6.64e-10 55 29 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Sodalis glossinidius (strain morsitans)
A1TUF2 7.08e-10 55 29 2 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paracidovorax citrulli (strain AAC00-1)
Q1GXC7 7.47e-10 55 29 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7NRT6 8.49e-10 55 32 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7VUW2 1.09e-09 55 28 2 119 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z5 1.09e-09 55 28 2 119 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC7 1.09e-09 55 28 2 119 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2SYK8 1.24e-09 55 28 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13UB4 1.24e-09 55 28 1 104 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Paraburkholderia xenovorans (strain LB400)
Q6LUS1 1.27e-09 55 30 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Photobacterium profundum (strain SS9)
Q43895 1.38e-09 55 38 1 78 3 None Uncharacterized protein in nifU 5'region Azospirillum brasilense
A4JRL3 1.47e-09 55 34 2 101 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B2UFK5 1.55e-09 55 27 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia pickettii (strain 12J)
C4K3H0 1.7e-09 54 31 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P74596 1.81e-09 54 26 1 105 1 slr1565 Uncharacterized protein slr1565 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A4SJ82 1.95e-09 54 29 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas salmonicida (strain A449)
B5EQH0 2.11e-09 54 35 5 108 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JAH6 2.11e-09 54 35 5 108 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A1WVE3 2.56e-09 54 29 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Halorhodospira halophila (strain DSM 244 / SL1)
A2SKL7 2.91e-09 54 28 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1S3U4 3.22e-09 53 33 0 86 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B4EUE2 3.29e-09 53 27 1 114 3 erpA Iron-sulfur cluster insertion protein ErpA Proteus mirabilis (strain HI4320)
B2JGV0 3.31e-09 54 28 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A9C177 3.37e-09 54 29 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Delftia acidovorans (strain DSM 14801 / SPH-1)
A5CVH1 3.62e-09 53 28 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q8Y242 3.67e-09 53 27 1 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C3LSN2 3.74e-09 53 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain M66-2)
Q9KU96 3.74e-09 53 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F947 3.74e-09 53 33 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B2AH60 3.96e-09 53 27 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q475T0 3.96e-09 53 27 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KED6 3.96e-09 53 27 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q220S8 4.14e-09 53 29 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A4G1T7 4.29e-09 53 28 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Herminiimonas arsenicoxydans
Q07184 4.38e-09 53 31 1 104 3 None Uncharacterized protein in nifU 5'region Rhodobacter capsulatus
Q8DBX7 4.72e-09 53 30 0 101 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain CMCP6)
A1ST94 4.92e-09 53 30 1 104 3 erpA Iron-sulfur cluster insertion protein ErpA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6SUP2 6.85e-09 53 28 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Janthinobacterium sp. (strain Marseille)
Q1LRC6 8.42e-09 53 27 1 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B0VML0 1.04e-08 52 35 5 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain SDF)
Q47IC1 1.15e-08 52 28 1 102 3 erpA Putative iron-sulfur cluster insertion protein ErpA Dechloromonas aromatica (strain RCB)
Q7MHZ0 1.22e-08 52 29 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain YJ016)
B8F870 1.27e-08 52 29 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Glaesserella parasuis serovar 5 (strain SH0165)
B0VAE9 1.45e-08 52 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AYE)
A3M0R4 1.45e-08 52 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I2I7 1.45e-08 52 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ACICU)
B7IAZ8 1.45e-08 52 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB0057)
B7GUY5 1.45e-08 52 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB307-0294)
Q7VQH5 1.63e-08 52 31 3 110 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella floridana
Q5QVQ4 1.67e-08 52 32 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q87LY4 1.79e-08 52 31 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B8D7B5 1.8e-08 52 24 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D910 1.8e-08 52 24 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A1WL78 1.81e-08 52 28 2 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Verminephrobacter eiseniae (strain EF01-2)
B7VJJ4 1.86e-08 52 33 4 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio atlanticus (strain LGP32)
Q124P0 2.03e-08 52 29 2 103 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3IHQ0 2.33e-08 51 32 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas translucida (strain TAC 125)
Q493N7 3.29e-08 51 27 3 118 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella pennsylvanica (strain BPEN)
A0A509ANY8 3.33e-08 52 32 3 115 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium berghei (strain Anka)
P57307 4.04e-08 51 24 1 106 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q6FG12 4.23e-08 50 29 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A7MUU6 9.06e-08 50 30 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio campbellii (strain ATCC BAA-1116)
Q8I3N6 2.14e-07 50 30 3 110 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium falciparum (isolate 3D7)
Q1LTN5 2.99e-07 48 29 3 107 3 erpA Iron-sulfur cluster insertion protein ErpA Baumannia cicadellinicola subsp. Homalodisca coagulata
A9KB96 3.04e-07 49 30 5 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain Dugway 5J108-111)
Q3JC94 4.09e-07 48 29 3 102 3 erpA Iron-sulfur cluster insertion protein ErpA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
O51930 7.11e-07 47 25 0 85 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q83AK7 9.24e-07 48 30 5 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAW9 9.24e-07 48 30 5 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 331 / Henzerling II)
Q89AQ6 1.13e-06 47 26 2 107 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8D3C7 5.96e-06 45 28 0 80 3 erpA Iron-sulfur cluster insertion protein ErpA Wigglesworthia glossinidia brevipalpis
A8FPL9 4.84e-05 44 29 1 96 3 nfuA Fe/S biogenesis protein NfuA Shewanella sediminis (strain HAW-EB3)
Q12425 0.000171 42 20 3 135 1 ISA2 Iron-sulfur assembly protein 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q60C62 0.000174 42 29 2 91 3 erpA1 Iron-sulfur cluster insertion protein ErpA 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q057T9 0.000297 40 28 0 74 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Cinara cedri (strain Cc)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_11760
Feature type CDS
Gene sufA
Product Fe-S cluster assembly scaffold SufA
Location 12176 - 12556 (strand: 1)
Length 381 (nucleotides) / 126 (amino acids)
In genomic island -

Contig

Accession ZDB_221
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1101
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01521 Iron-sulphur cluster biosynthesis

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0316 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly iron-binding protein IscA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05997 Fe-S cluster assembly protein SufA - -

Protein Sequence

MTTHSTNPVETFSLNDNDWTGITLTAAAAKQIVTLMKNTPDSIGLCLSVKQSGCAGFGYVFEMINQADAEDMLFERDGARLYVPRKAMPFIDGTEVDFVREGLNQIFKFNNPKAQHACGCGESFGV

Flanking regions ( +/- flanking 50bp)

ATTAACATGATGTTTACGGAGAGCTCCCGTCGAATTTTATGAGGTCAATAATGACAACGCACAGCACCAACCCGGTGGAAACTTTTTCACTGAATGATAATGACTGGACAGGTATCACACTGACAGCGGCCGCTGCAAAGCAGATTGTGACACTGATGAAAAACACCCCGGACAGTATCGGGCTTTGCCTGAGTGTCAAACAATCCGGTTGTGCCGGGTTTGGTTATGTTTTTGAAATGATTAATCAGGCGGATGCAGAGGATATGTTGTTTGAGCGCGACGGCGCCCGGCTGTATGTCCCGCGCAAAGCCATGCCGTTTATCGACGGCACAGAAGTGGATTTTGTCCGTGAAGGGCTGAATCAGATATTTAAATTTAATAATCCGAAAGCTCAGCATGCCTGCGGGTGTGGTGAAAGCTTCGGGGTTTAAGAGCGAAGCCATATTATGTCTCAGAGCAATGCAGAGATTGGTGAAGACGT