Homologs in group_1021

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05710 FBDBKF_05710 88.4 Morganella morganii S1 grxD Grx4 family monothiol glutaredoxin
EHELCC_11880 EHELCC_11880 88.4 Morganella morganii S2 grxD Grx4 family monothiol glutaredoxin
NLDBIP_12220 NLDBIP_12220 88.4 Morganella morganii S4 grxD Grx4 family monothiol glutaredoxin
LHKJJB_12080 LHKJJB_12080 88.4 Morganella morganii S3 grxD Grx4 family monothiol glutaredoxin
HKOGLL_10695 HKOGLL_10695 88.4 Morganella morganii S5 grxD Grx4 family monothiol glutaredoxin
F4V73_RS03595 F4V73_RS03595 83.0 Morganella psychrotolerans - Grx4 family monothiol glutaredoxin

Distribution of the homologs in the orthogroup group_1021

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1021

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AC72 3.62e-71 210 88 0 109 3 grxD Glutaredoxin 4 Shigella flexneri
P0AC69 3.62e-71 210 88 0 109 1 grxD Glutaredoxin 4 Escherichia coli (strain K12)
P0AC70 3.62e-71 210 88 0 109 3 grxD Glutaredoxin 4 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC71 3.62e-71 210 88 0 109 3 grxD Glutaredoxin 4 Escherichia coli O157:H7
O30824 3.51e-57 175 75 0 106 3 grxD Glutaredoxin 4 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CMN5 1.91e-56 173 73 0 109 3 grxD Glutaredoxin 4 Pasteurella multocida (strain Pm70)
Q4QLD2 2.67e-55 170 73 0 106 3 grxD Glutaredoxin 4 Haemophilus influenzae (strain 86-028NP)
P45085 2.08e-54 168 72 0 106 3 grxD Glutaredoxin 4 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9V6 1.55e-53 166 70 0 103 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AR8 4.14e-53 164 71 0 96 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57284 1.46e-50 158 72 0 94 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q48833 6.38e-40 130 66 0 86 3 grlA Probable monothiol glutaredoxin GrlA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q68W05 1.05e-33 115 47 0 95 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UK94 6.85e-33 113 47 0 98 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O05957 2.44e-32 112 44 0 101 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia prowazekii (strain Madrid E)
Q92GH5 3.03e-32 112 50 0 94 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q555C8 8.53e-30 107 45 0 100 3 grx5 Monothiol glutaredoxin-5, mitochondrial Dictyostelium discoideum
Q9HDW8 2.16e-28 103 42 1 102 1 grx5 Monothiol glutaredoxin-5, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P73056 2.17e-28 102 41 0 98 3 slr1846 Uncharacterized monothiol glutaredoxin ycf64-like Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8LBK6 4.61e-28 103 40 0 97 1 GRXS15 Monothiol glutaredoxin-S15, mitochondrial Arabidopsis thaliana
Q0JM76 7.12e-28 103 41 0 112 2 GRXS4 Monothiol glutaredoxin-S4, mitochondrial Oryza sativa subsp. japonica
Q0JQ97 2.01e-27 102 41 0 112 2 GRXS1 Monothiol glutaredoxin-S1, mitochondrial Oryza sativa subsp. japonica
Q6YFE4 3.33e-27 100 42 2 112 3 GRX5 Monothiol glutaredoxin-5, mitochondrial Lachancea kluyveri
P51384 1.39e-26 97 44 0 90 3 ycf64 Uncharacterized monothiol glutaredoxin ycf64 Porphyra purpurea
Q0IWL9 2.74e-26 104 43 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q0IWL9 1.79e-25 102 44 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q0IWL9 5.64e-21 89 39 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q86H62 7.16e-26 99 43 0 91 3 glrx3 Glutaredoxin-3 homolog Dictyostelium discoideum
Q1XDA3 1.63e-25 95 39 0 94 3 ycf64 Uncharacterized monothiol glutaredoxin ycf64 Neopyropia yezoensis
Q86SX6 2.04e-25 96 39 1 98 1 GLRX5 Glutaredoxin-related protein 5, mitochondrial Homo sapiens
Q80Y14 2.58e-25 95 39 1 98 1 Glrx5 Glutaredoxin-related protein 5, mitochondrial Mus musculus
Q02784 6.04e-25 94 40 2 114 1 GRX5 Monothiol glutaredoxin-5, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q851Y7 1.19e-24 94 41 0 95 2 GRXS7 Monothiol glutaredoxin-S7, chloroplastic Oryza sativa subsp. japonica
Q84Y95 1.39e-24 94 43 0 92 1 GRXS14 Monothiol glutaredoxin-S14, chloroplastic Arabidopsis thaliana
Q8H7F6 1.73e-24 97 44 1 99 1 GRXS16 Bifunctional monothiol glutaredoxin-S16, chloroplastic Arabidopsis thaliana
Q6PBM1 2.04e-24 93 40 2 99 2 glrx5 Glutaredoxin-related protein 5, mitochondrial Danio rerio
Q2QX01 3.42e-24 96 44 1 98 2 GRXS12 Monothiol glutaredoxin-S12, chloroplastic Oryza sativa subsp. japonica
Q5XJ54 3.5e-24 97 40 0 99 2 glrx3 Glutaredoxin 3 Danio rerio
Q5XJ54 1.89e-22 92 40 0 95 2 glrx3 Glutaredoxin 3 Danio rerio
Q9ZPH2 8.73e-24 97 41 0 97 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q9ZPH2 5.54e-23 95 38 0 107 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q9ZPH2 8.23e-23 94 42 0 96 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q28ID3 5.65e-23 93 41 0 96 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q28ID3 2.25e-22 92 43 0 93 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q03835 6.9e-22 89 44 0 83 1 GRX3 Monothiol glutaredoxin-3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P32642 7.18e-22 89 44 0 83 1 GRX4 Monothiol glutaredoxin-4 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O74790 1.85e-21 88 37 0 95 1 grx4 Monothiol glutaredoxin-4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q58DA7 1.57e-20 87 39 0 96 2 GLRX3 Glutaredoxin-3 Bos taurus
Q58DA7 2.8e-20 86 44 0 84 2 GLRX3 Glutaredoxin-3 Bos taurus
O76003 2.3e-20 86 38 0 96 1 GLRX3 Glutaredoxin-3 Homo sapiens
O76003 8.39e-20 85 39 0 93 1 GLRX3 Glutaredoxin-3 Homo sapiens
Q9JLZ1 3.26e-20 86 39 0 93 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
Q9JLZ1 1.55e-19 84 37 0 96 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
Q9CQM9 3.54e-20 86 39 0 93 1 Glrx3 Glutaredoxin-3 Mus musculus
Q9CQM9 1.72e-19 84 37 0 96 1 Glrx3 Glutaredoxin-3 Mus musculus
Q8L8T2 2.14e-06 46 23 2 103 2 GRXC1 Glutaredoxin-C1 Arabidopsis thaliana
P0AC62 2.57e-06 45 32 0 73 1 grxC Glutaredoxin 3 Escherichia coli (strain K12)
P0AC63 2.57e-06 45 32 0 73 3 grxC Glutaredoxin 3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC64 2.57e-06 45 32 0 73 3 grxC Glutaredoxin 3 Escherichia coli O157:H7
Q9HU55 4.07e-06 44 30 1 86 3 grx Glutaredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0J3L4 1.23e-05 45 21 2 101 2 GRXS10 Monothiol glutaredoxin-S10 Oryza sativa subsp. japonica
Q54EX7 4.31e-05 42 25 3 102 3 grxB Glutaredoxin-like protein Dictyostelium discoideum
Q8LBS4 5.1e-05 43 24 2 105 1 GRXS12 Monothiol glutaredoxin-S12, chloroplastic Arabidopsis thaliana
Q9SA68 7.08e-05 42 28 3 100 3 GRXS1 Monothiol glutaredoxin-S1 Arabidopsis thaliana
Q9ZR41 0.000126 41 24 2 102 3 None Glutaredoxin Solanum lycopersicum
Q9UTI2 0.00021 40 25 2 103 3 grx2 Glutaredoxin-2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P55142 0.000285 40 22 2 101 1 GRXC6 Glutaredoxin-C6 Oryza sativa subsp. japonica
O81187 0.000439 40 25 1 78 3 None Glutaredoxin Vernicia fordii

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06735
Feature type CDS
Gene -
Product Grx4 family monothiol glutaredoxin
Location 1470977 - 1471315 (strand: -1)
Length 339 (nucleotides) / 112 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1021
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00462 Glutaredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0278 Posttranslational modification, protein turnover, chaperones (O) O Glutaredoxin-related protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07390 monothiol glutaredoxin - -

Protein Sequence

MTTIEKIERQIKENPILLYMKGSPKLPSCGFSAQAVQAISACGERFAYVDILQNPDIRAELPKYAHWPTFPQLWVDGELVGGCDIILEMYQRGELQKLLKETADKYRGEEEA

Flanking regions ( +/- flanking 50bp)

TCCTCAATATAAAACATACTGAATATAAAAAGGTTGTAAGGACTTAATAAATGACGACTATCGAAAAAATTGAACGCCAAATCAAAGAAAATCCCATCCTGTTATACATGAAAGGATCACCAAAATTACCAAGCTGTGGATTTTCTGCACAAGCCGTTCAAGCGATTTCTGCTTGTGGTGAGCGTTTTGCTTATGTCGATATTTTGCAAAACCCTGATATTCGTGCAGAGCTACCAAAATATGCTCATTGGCCAACTTTCCCACAATTATGGGTGGATGGCGAATTAGTCGGTGGTTGTGACATTATCTTAGAAATGTATCAGCGCGGTGAATTGCAGAAGTTATTAAAAGAGACTGCAGATAAATACCGTGGTGAAGAAGAAGCATAATCCCCATTGCGTTTTTCACCATGATTTAAATTGACCGTAATTAAAAAAAG