Homologs in group_1089

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05710 FBDBKF_05710 100.0 Morganella morganii S1 grxD Grx4 family monothiol glutaredoxin
EHELCC_11880 EHELCC_11880 100.0 Morganella morganii S2 grxD Grx4 family monothiol glutaredoxin
NLDBIP_12220 NLDBIP_12220 100.0 Morganella morganii S4 grxD Grx4 family monothiol glutaredoxin
LHKJJB_12080 LHKJJB_12080 100.0 Morganella morganii S3 grxD Grx4 family monothiol glutaredoxin
F4V73_RS03595 F4V73_RS03595 90.2 Morganella psychrotolerans - Grx4 family monothiol glutaredoxin
PMI_RS06735 PMI_RS06735 88.4 Proteus mirabilis HI4320 - Grx4 family monothiol glutaredoxin

Distribution of the homologs in the orthogroup group_1089

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1089

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AC72 2.01e-72 214 90 0 110 3 grxD Glutaredoxin 4 Shigella flexneri
P0AC69 2.01e-72 214 90 0 110 1 grxD Glutaredoxin 4 Escherichia coli (strain K12)
P0AC70 2.01e-72 214 90 0 110 3 grxD Glutaredoxin 4 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC71 2.01e-72 214 90 0 110 3 grxD Glutaredoxin 4 Escherichia coli O157:H7
Q9CMN5 2.56e-58 178 75 0 107 3 grxD Glutaredoxin 4 Pasteurella multocida (strain Pm70)
O30824 1.62e-57 176 75 0 104 3 grxD Glutaredoxin 4 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QLD2 3.99e-56 172 74 0 104 3 grxD Glutaredoxin 4 Haemophilus influenzae (strain 86-028NP)
P45085 4.27e-55 169 73 0 104 3 grxD Glutaredoxin 4 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q89AR8 2.05e-52 163 68 0 100 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K9V6 1.56e-51 160 69 0 102 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57284 1.44e-49 155 67 0 107 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q48833 1.8e-40 132 64 0 88 3 grlA Probable monothiol glutaredoxin GrlA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q68W05 4.47e-31 109 44 0 95 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UK94 6.92e-30 105 44 0 98 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O05957 1.01e-29 105 41 0 102 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia prowazekii (strain Madrid E)
Q92GH5 1.21e-29 105 46 0 94 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q0JM76 6.53e-29 105 44 1 106 2 GRXS4 Monothiol glutaredoxin-S4, mitochondrial Oryza sativa subsp. japonica
Q555C8 4.38e-28 102 41 0 106 3 grx5 Monothiol glutaredoxin-5, mitochondrial Dictyostelium discoideum
Q9HDW8 4.91e-28 102 40 1 107 1 grx5 Monothiol glutaredoxin-5, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q0JQ97 3.63e-27 101 44 0 100 2 GRXS1 Monothiol glutaredoxin-S1, mitochondrial Oryza sativa subsp. japonica
P51384 8.29e-27 98 42 0 98 3 ycf64 Uncharacterized monothiol glutaredoxin ycf64 Porphyra purpurea
P73056 1.56e-26 97 39 0 103 3 slr1846 Uncharacterized monothiol glutaredoxin ycf64-like Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1XDA3 3.47e-26 96 38 0 104 3 ycf64 Uncharacterized monothiol glutaredoxin ycf64 Neopyropia yezoensis
Q84Y95 1.06e-25 97 45 0 92 1 GRXS14 Monothiol glutaredoxin-S14, chloroplastic Arabidopsis thaliana
Q8LBK6 1.07e-25 97 37 0 98 1 GRXS15 Monothiol glutaredoxin-S15, mitochondrial Arabidopsis thaliana
Q86H62 1.37e-25 99 45 0 91 3 glrx3 Glutaredoxin-3 homolog Dictyostelium discoideum
Q0IWL9 2.3e-25 101 44 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q0IWL9 2.3e-24 99 43 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q0IWL9 4.02e-21 90 40 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q5XJ54 2.3e-25 100 42 0 100 2 glrx3 Glutaredoxin 3 Danio rerio
Q5XJ54 4.31e-22 91 38 1 101 2 glrx3 Glutaredoxin 3 Danio rerio
Q6YFE4 2.51e-25 95 39 1 114 3 GRX5 Monothiol glutaredoxin-5, mitochondrial Lachancea kluyveri
Q851Y7 4.09e-25 95 42 1 97 2 GRXS7 Monothiol glutaredoxin-S7, chloroplastic Oryza sativa subsp. japonica
Q02784 4.1e-25 95 39 2 117 1 GRX5 Monothiol glutaredoxin-5, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9ZPH2 7.98e-25 100 43 0 97 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q9ZPH2 7.58e-23 94 42 0 96 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q9ZPH2 3.13e-22 93 41 0 96 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q2QX01 1.92e-24 97 44 2 106 2 GRXS12 Monothiol glutaredoxin-S12, chloroplastic Oryza sativa subsp. japonica
Q86SX6 2.88e-24 93 40 1 92 1 GLRX5 Glutaredoxin-related protein 5, mitochondrial Homo sapiens
Q80Y14 3.55e-24 92 35 1 109 1 Glrx5 Glutaredoxin-related protein 5, mitochondrial Mus musculus
P32642 1.94e-23 93 45 0 83 1 GRX4 Monothiol glutaredoxin-4 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8H7F6 2e-23 94 43 1 99 1 GRXS16 Bifunctional monothiol glutaredoxin-S16, chloroplastic Arabidopsis thaliana
Q28ID3 2.98e-23 94 46 0 90 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q28ID3 7.38e-22 90 40 0 96 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q6PBM1 3.11e-23 90 39 1 92 2 glrx5 Glutaredoxin-related protein 5, mitochondrial Danio rerio
Q03835 4.83e-23 92 44 0 86 1 GRX3 Monothiol glutaredoxin-3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O74790 9.61e-22 89 37 0 95 1 grx4 Monothiol glutaredoxin-4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9JLZ1 3.14e-21 89 43 0 90 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
Q9JLZ1 3.67e-20 86 38 0 96 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
Q9CQM9 3.24e-21 89 43 0 90 1 Glrx3 Glutaredoxin-3 Mus musculus
Q9CQM9 3.9e-20 86 38 0 96 1 Glrx3 Glutaredoxin-3 Mus musculus
Q58DA7 3.41e-21 89 40 0 96 2 GLRX3 Glutaredoxin-3 Bos taurus
Q58DA7 1.73e-20 87 42 0 90 2 GLRX3 Glutaredoxin-3 Bos taurus
O76003 4.64e-21 88 39 0 96 1 GLRX3 Glutaredoxin-3 Homo sapiens
O76003 2.22e-20 87 42 0 90 1 GLRX3 Glutaredoxin-3 Homo sapiens
Q8L8T2 3.88e-08 50 25 2 108 2 GRXC1 Glutaredoxin-C1 Arabidopsis thaliana
P0AC62 1.9e-06 45 31 0 73 1 grxC Glutaredoxin 3 Escherichia coli (strain K12)
P0AC63 1.9e-06 45 31 0 73 3 grxC Glutaredoxin 3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC64 1.9e-06 45 31 0 73 3 grxC Glutaredoxin 3 Escherichia coli O157:H7
Q6K953 8.37e-06 45 25 2 104 3 GRXC4 Glutaredoxin-C4, chloroplastic Oryza sativa subsp. japonica
Q9ZR41 2.64e-05 43 23 2 111 3 None Glutaredoxin Solanum lycopersicum
Q9HU55 2.82e-05 42 29 1 85 3 grx Glutaredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8LBS4 4.28e-05 43 22 2 105 1 GRXS12 Monothiol glutaredoxin-S12, chloroplastic Arabidopsis thaliana
Q0J3L4 4.34e-05 43 24 4 102 2 GRXS10 Monothiol glutaredoxin-S10 Oryza sativa subsp. japonica
Q8L8Z8 4.76e-05 42 26 3 110 3 GRXS2 Monothiol glutaredoxin-S2 Arabidopsis thaliana
Q19297 6.43e-05 42 35 0 54 3 F10D7.3 Uncharacterized monothiol glutaredoxin F10D7.3 Caenorhabditis elegans
Q54EX7 8.29e-05 42 39 0 38 3 grxB Glutaredoxin-like protein Dictyostelium discoideum
O81187 0.000125 41 28 2 81 3 None Glutaredoxin Vernicia fordii
P12309 0.000191 40 24 2 101 1 GLRX Glutaredoxin-1 Sus scrofa
Q9FNE2 0.000205 40 24 3 104 3 GRXC2 Glutaredoxin-C2 Arabidopsis thaliana
P55143 0.000283 40 23 3 104 3 None Glutaredoxin Ricinus communis
P55142 0.000283 40 21 2 104 1 GRXC6 Glutaredoxin-C6 Oryza sativa subsp. japonica
Q9SA68 0.000334 40 24 2 104 3 GRXS1 Monothiol glutaredoxin-S1 Arabidopsis thaliana
P12864 0.00058 39 24 2 103 1 GLRX Glutaredoxin-1 Oryctolagus cuniculus
P10575 0.000754 39 23 2 101 1 GLRX Glutaredoxin-1 Bos taurus

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_10695
Feature type CDS
Gene grxD
Product Grx4 family monothiol glutaredoxin
Location 33469 - 33810 (strand: 1)
Length 342 (nucleotides) / 113 (amino acids)
In genomic island -

Contig

Accession ZDB_688
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1089
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00462 Glutaredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0278 Posttranslational modification, protein turnover, chaperones (O) O Glutaredoxin-related protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07390 monothiol glutaredoxin - -

Protein Sequence

MTTTIEKIERQIKENPILLYMKGSPKLPSCGFSAQAVQALAACEERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIIMEMFQRGELQPLIKETAAKYRTENEE

Flanking regions ( +/- flanking 50bp)

CGGGTAAGTTAACACCGGTACTAACCGATCTGAAGTGAAGGACGTTTTACATGACGACGACTATTGAAAAAATCGAACGCCAGATTAAAGAAAACCCGATTCTGCTGTATATGAAGGGCTCTCCGAAGCTGCCGAGCTGCGGTTTTTCCGCGCAGGCTGTGCAGGCGCTGGCTGCCTGTGAAGAGCGTTTTGCTTATGTGGATATTCTGCAGAATCCGGATATCCGTGCTGAATTACCAAAATACGCTAACTGGCCGACGTTCCCGCAACTGTGGGTTGACGGTGAGCTGGTCGGCGGCTGTGATATCATTATGGAAATGTTCCAGCGCGGTGAATTACAGCCACTGATTAAAGAAACCGCAGCAAAATACCGGACTGAAAACGAAGAATAATCACGTCCCGTACTGTTTAGAAAAGCCCTGCAGTGTCACCGCTGCGGGGC