Homologs in group_1021

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05710 FBDBKF_05710 90.2 Morganella morganii S1 grxD Grx4 family monothiol glutaredoxin
EHELCC_11880 EHELCC_11880 90.2 Morganella morganii S2 grxD Grx4 family monothiol glutaredoxin
NLDBIP_12220 NLDBIP_12220 90.2 Morganella morganii S4 grxD Grx4 family monothiol glutaredoxin
LHKJJB_12080 LHKJJB_12080 90.2 Morganella morganii S3 grxD Grx4 family monothiol glutaredoxin
HKOGLL_10695 HKOGLL_10695 90.2 Morganella morganii S5 grxD Grx4 family monothiol glutaredoxin
PMI_RS06735 PMI_RS06735 83.0 Proteus mirabilis HI4320 - Grx4 family monothiol glutaredoxin

Distribution of the homologs in the orthogroup group_1021

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1021

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AC72 8.9e-66 197 86 0 108 3 grxD Glutaredoxin 4 Shigella flexneri
P0AC69 8.9e-66 197 86 0 108 1 grxD Glutaredoxin 4 Escherichia coli (strain K12)
P0AC70 8.9e-66 197 86 0 108 3 grxD Glutaredoxin 4 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC71 8.9e-66 197 86 0 108 3 grxD Glutaredoxin 4 Escherichia coli O157:H7
Q9CMN5 2.43e-57 175 72 0 109 3 grxD Glutaredoxin 4 Pasteurella multocida (strain Pm70)
O30824 2.31e-56 172 72 0 106 3 grxD Glutaredoxin 4 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QLD2 3.79e-56 172 72 0 106 3 grxD Glutaredoxin 4 Haemophilus influenzae (strain 86-028NP)
P45085 3.52e-55 170 71 0 106 3 grxD Glutaredoxin 4 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9V6 3.23e-52 162 70 0 103 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AR8 1.58e-49 155 67 0 96 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57284 5.7e-49 154 71 0 94 3 grxD Glutaredoxin 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q48833 5.21e-37 123 59 0 88 3 grlA Probable monothiol glutaredoxin GrlA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q68W05 5.68e-30 106 44 0 95 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UK94 1.13e-29 105 45 0 98 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92GH5 3.78e-29 104 47 0 94 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O05957 1.34e-28 102 41 0 102 3 grxC2 Probable monothiol glutaredoxin 2 Rickettsia prowazekii (strain Madrid E)
Q9HDW8 1.83e-28 103 40 2 116 1 grx5 Monothiol glutaredoxin-5, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q0JM76 1.25e-27 102 42 0 105 2 GRXS4 Monothiol glutaredoxin-S4, mitochondrial Oryza sativa subsp. japonica
Q555C8 2.8e-27 100 41 0 101 3 grx5 Monothiol glutaredoxin-5, mitochondrial Dictyostelium discoideum
Q02784 3.21e-27 100 41 2 115 1 GRX5 Monothiol glutaredoxin-5, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q84Y95 5.27e-27 100 46 0 92 1 GRXS14 Monothiol glutaredoxin-S14, chloroplastic Arabidopsis thaliana
Q5XJ54 1.72e-26 102 42 0 100 2 glrx3 Glutaredoxin 3 Danio rerio
Q5XJ54 1.6e-22 92 37 0 95 2 glrx3 Glutaredoxin 3 Danio rerio
Q0JQ97 2.88e-26 99 42 0 106 2 GRXS1 Monothiol glutaredoxin-S1, mitochondrial Oryza sativa subsp. japonica
Q8LBK6 4.53e-26 98 38 0 98 1 GRXS15 Monothiol glutaredoxin-S15, mitochondrial Arabidopsis thaliana
Q86H62 1.13e-25 99 45 0 94 3 glrx3 Glutaredoxin-3 homolog Dictyostelium discoideum
P51384 1.51e-25 95 42 0 98 3 ycf64 Uncharacterized monothiol glutaredoxin ycf64 Porphyra purpurea
Q6YFE4 1.87e-25 95 38 1 112 3 GRX5 Monothiol glutaredoxin-5, mitochondrial Lachancea kluyveri
Q2QX01 2.05e-25 99 46 1 98 2 GRXS12 Monothiol glutaredoxin-S12, chloroplastic Oryza sativa subsp. japonica
Q0IWL9 2.15e-25 102 45 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q0IWL9 2.42e-25 101 44 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q0IWL9 9.84e-22 91 42 0 97 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q1XDA3 3.2e-25 94 40 0 94 3 ycf64 Uncharacterized monothiol glutaredoxin ycf64 Neopyropia yezoensis
Q9ZPH2 6.68e-25 100 44 0 97 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q9ZPH2 5.82e-23 95 41 0 96 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q9ZPH2 1.05e-22 94 43 0 96 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q851Y7 1.01e-24 94 44 0 90 2 GRXS7 Monothiol glutaredoxin-S7, chloroplastic Oryza sativa subsp. japonica
P73056 1.2e-24 92 38 0 102 3 slr1846 Uncharacterized monothiol glutaredoxin ycf64-like Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q28ID3 2.61e-24 97 45 0 93 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q28ID3 5.42e-23 93 40 0 96 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q80Y14 5.46e-24 92 34 1 109 1 Glrx5 Glutaredoxin-related protein 5, mitochondrial Mus musculus
P32642 8.52e-24 94 46 0 83 1 GRX4 Monothiol glutaredoxin-4 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q86SX6 1.07e-23 92 34 1 109 1 GLRX5 Glutaredoxin-related protein 5, mitochondrial Homo sapiens
Q03835 1.85e-23 93 45 0 85 1 GRX3 Monothiol glutaredoxin-3 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6PBM1 3.13e-23 90 39 1 92 2 glrx5 Glutaredoxin-related protein 5, mitochondrial Danio rerio
Q9CQM9 5.78e-23 94 43 0 93 1 Glrx3 Glutaredoxin-3 Mus musculus
Q9CQM9 2.64e-19 84 37 0 96 1 Glrx3 Glutaredoxin-3 Mus musculus
Q8H7F6 5.87e-23 93 43 1 98 1 GRXS16 Bifunctional monothiol glutaredoxin-S16, chloroplastic Arabidopsis thaliana
O74790 3.34e-22 90 38 0 95 1 grx4 Monothiol glutaredoxin-4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q58DA7 3.83e-22 91 41 0 93 2 GLRX3 Glutaredoxin-3 Bos taurus
Q58DA7 3.65e-20 86 39 0 96 2 GLRX3 Glutaredoxin-3 Bos taurus
O76003 4.53e-22 91 41 0 93 1 GLRX3 Glutaredoxin-3 Homo sapiens
O76003 5.08e-20 85 38 0 96 1 GLRX3 Glutaredoxin-3 Homo sapiens
Q9JLZ1 1.52e-21 90 43 0 93 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
Q9JLZ1 4.07e-18 80 37 0 96 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
Q9HU55 3.84e-08 50 32 1 85 3 grx Glutaredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0J3L4 3.35e-07 49 28 4 102 2 GRXS10 Monothiol glutaredoxin-S10 Oryza sativa subsp. japonica
Q8LBS4 5.76e-07 48 26 2 106 1 GRXS12 Monothiol glutaredoxin-S12, chloroplastic Arabidopsis thaliana
Q8L8T2 2.88e-06 46 25 2 104 2 GRXC1 Glutaredoxin-C1 Arabidopsis thaliana
Q9QUH0 9.27e-06 44 25 2 103 1 Glrx Glutaredoxin-1 Mus musculus
P12309 1.19e-05 43 26 2 101 1 GLRX Glutaredoxin-1 Sus scrofa
P35754 2.91e-05 43 25 2 103 1 GLRX Glutaredoxin-1 Homo sapiens
Q9ZR41 2.99e-05 43 25 2 105 3 None Glutaredoxin Solanum lycopersicum
Q6K953 4.8e-05 43 25 2 104 3 GRXC4 Glutaredoxin-C4, chloroplastic Oryza sativa subsp. japonica
P12864 5.26e-05 42 25 2 103 1 GLRX Glutaredoxin-1 Oryctolagus cuniculus
Q9ESH6 8.33e-05 42 24 2 103 3 Glrx Glutaredoxin-1 Rattus norvegicus
Q9SA68 8.38e-05 41 27 4 105 3 GRXS1 Monothiol glutaredoxin-S1 Arabidopsis thaliana
P10575 0.000115 41 25 2 101 1 GLRX Glutaredoxin-1 Bos taurus
Q8L8Z8 0.000129 41 27 3 108 3 GRXS2 Monothiol glutaredoxin-S2 Arabidopsis thaliana
Q9FNE2 0.000634 39 24 3 104 3 GRXC2 Glutaredoxin-C2 Arabidopsis thaliana
Q54EX7 0.00085 39 31 0 44 3 grxB Glutaredoxin-like protein Dictyostelium discoideum

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03595
Feature type CDS
Gene -
Product Grx4 family monothiol glutaredoxin
Location 766607 - 766945 (strand: 1)
Length 339 (nucleotides) / 112 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1021
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00462 Glutaredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0278 Posttranslational modification, protein turnover, chaperones (O) O Glutaredoxin-related protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07390 monothiol glutaredoxin - -

Protein Sequence

MTTIEKIERQIKENPILLYMKGSPKLPSCGFSAQAVQALASCEERFAYVDILQNPDIRAELPKYANWPTFPQLWIGGELVGGCDIIMEMMRSGELQTLIKETAAKNPAENEE

Flanking regions ( +/- flanking 50bp)

CATGAAAGTTAACACCGGCACTGACCGGTCAGATGTAAAGGATATTTTAAATGACGACTATTGAAAAAATTGAACGCCAGATCAAAGAAAACCCGATTCTGCTGTATATGAAAGGCTCACCGAAACTGCCTAGCTGTGGTTTTTCAGCGCAGGCTGTTCAGGCGCTGGCATCTTGTGAAGAGCGTTTTGCGTATGTAGATATCCTGCAAAACCCTGATATTCGTGCGGAATTACCAAAGTACGCAAACTGGCCGACATTTCCGCAACTGTGGATTGGCGGGGAATTAGTCGGTGGTTGTGACATCATTATGGAAATGATGCGCAGCGGCGAATTACAGACGCTGATTAAAGAAACAGCCGCCAAAAATCCGGCTGAAAACGAAGAATAATCATACAGTCAGAATGAACAAAAAAGCCCTGCCGGTGTTTCCGGCGGGGC