Homologs in group_1084

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05680 FBDBKF_05680 61.9 Morganella morganii S1 - Glycine zipper 2TM domain-containing protein
EHELCC_11910 EHELCC_11910 61.9 Morganella morganii S2 - Glycine zipper 2TM domain-containing protein
NLDBIP_12250 NLDBIP_12250 61.9 Morganella morganii S4 - Glycine zipper 2TM domain-containing protein
LHKJJB_12110 LHKJJB_12110 61.9 Morganella morganii S3 - Glycine zipper 2TM domain-containing protein
HKOGLL_10725 HKOGLL_10725 61.9 Morganella morganii S5 - Glycine zipper 2TM domain-containing protein
F4V73_RS03625 F4V73_RS03625 63.2 Morganella psychrotolerans - glycine zipper 2TM domain-containing protein

Distribution of the homologs in the orthogroup group_1084

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1084

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1X0 7.37e-55 172 65 0 155 1 slyB Outer membrane lipoprotein SlyB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1X1 7.37e-55 172 65 0 155 3 slyB Outer membrane lipoprotein SlyB Salmonella typhi
P0A907 6.71e-54 170 63 0 155 3 slyB Outer membrane lipoprotein SlyB Shigella flexneri
P0A905 6.71e-54 170 63 0 155 2 slyB Outer membrane lipoprotein SlyB Escherichia coli (strain K12)
P0A906 6.71e-54 170 63 0 155 3 slyB Outer membrane lipoprotein SlyB Escherichia coli O157:H7
P31484 2.13e-51 164 63 0 155 3 pcp Outer membrane lipoprotein pcp Yersinia enterocolitica
P10325 6.34e-28 104 43 1 150 1 pcp Outer membrane lipoprotein pcp Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AB37 3.68e-07 50 49 1 53 4 ycfJ Uncharacterized protein YcfJ Shigella flexneri
P0AB35 3.68e-07 50 49 1 53 4 ycfJ Uncharacterized protein YcfJ Escherichia coli (strain K12)
P0AB36 3.68e-07 50 49 1 53 4 ycfJ Uncharacterized protein YcfJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06710
Feature type CDS
Gene -
Product glycine zipper 2TM domain-containing protein
Location 1467591 - 1468058 (strand: 1)
Length 468 (nucleotides) / 155 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1084
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05433 Glycine zipper 2TM domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3133 Cell wall/membrane/envelope biogenesis (M) M Outer membrane lipoprotein SlyB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06077 outer membrane lipoprotein SlyB - -

Protein Sequence

MFKHLLVGLFAVTTLAGCVNTSSLSGDTYTASQAKQAQNVTYGTIVSVRAVNIQAGSDENVLGAIGGAVLGGLLGNTIGGGTGRNLATAAGAIAGGMAGQQAQGALNTTKGVQLEVRLDSGKTVVVVQKADNTAYRQGQRVAVIGNGNNLTVSPR

Flanking regions ( +/- flanking 50bp)

AAATTGATATAATCTGAAAAATTATTATCAGATTTCCATTAGGAGTAATTATGTTTAAGCATTTACTTGTTGGTCTTTTTGCTGTGACAACGCTGGCTGGTTGTGTAAATACAAGCTCTTTATCAGGTGATACTTATACAGCAAGTCAAGCTAAACAAGCACAAAACGTAACTTATGGCACCATTGTTTCAGTACGTGCAGTAAACATTCAAGCCGGTAGTGATGAAAATGTTCTTGGTGCTATCGGTGGTGCCGTATTAGGTGGTTTATTAGGTAATACAATTGGTGGTGGTACAGGCCGTAACCTAGCAACCGCAGCGGGTGCTATTGCTGGTGGTATGGCTGGACAACAAGCACAAGGTGCTTTAAACACAACCAAGGGTGTGCAATTGGAAGTACGTTTAGATAGCGGTAAAACTGTGGTTGTCGTACAAAAAGCAGACAATACTGCCTATAGACAAGGTCAACGTGTTGCTGTGATTGGTAACGGCAATAATCTCACCGTTTCTCCACGCTAAGTTTATTTACTTGAGGTGTGTGATAAGCAAAACAGGCAACCATTCTAGTT