Homologs in group_1084

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05680 FBDBKF_05680 91.0 Morganella morganii S1 - Glycine zipper 2TM domain-containing protein
EHELCC_11910 EHELCC_11910 91.0 Morganella morganii S2 - Glycine zipper 2TM domain-containing protein
NLDBIP_12250 NLDBIP_12250 91.0 Morganella morganii S4 - Glycine zipper 2TM domain-containing protein
LHKJJB_12110 LHKJJB_12110 91.0 Morganella morganii S3 - Glycine zipper 2TM domain-containing protein
HKOGLL_10725 HKOGLL_10725 91.0 Morganella morganii S5 - Glycine zipper 2TM domain-containing protein
PMI_RS06710 PMI_RS06710 63.2 Proteus mirabilis HI4320 - glycine zipper 2TM domain-containing protein

Distribution of the homologs in the orthogroup group_1084

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1084

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31484 3.87e-58 181 67 0 155 3 pcp Outer membrane lipoprotein pcp Yersinia enterocolitica
P0A1X0 5.73e-54 170 65 0 155 1 slyB Outer membrane lipoprotein SlyB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1X1 5.73e-54 170 65 0 155 3 slyB Outer membrane lipoprotein SlyB Salmonella typhi
P0A907 2.41e-52 166 63 0 155 3 slyB Outer membrane lipoprotein SlyB Shigella flexneri
P0A905 2.41e-52 166 63 0 155 2 slyB Outer membrane lipoprotein SlyB Escherichia coli (strain K12)
P0A906 2.41e-52 166 63 0 155 3 slyB Outer membrane lipoprotein SlyB Escherichia coli O157:H7
P10325 8.07e-27 101 46 2 154 1 pcp Outer membrane lipoprotein pcp Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AB37 9.16e-07 49 36 1 73 4 ycfJ Uncharacterized protein YcfJ Shigella flexneri
P0AB35 9.16e-07 49 36 1 73 4 ycfJ Uncharacterized protein YcfJ Escherichia coli (strain K12)
P0AB36 9.16e-07 49 36 1 73 4 ycfJ Uncharacterized protein YcfJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03625
Feature type CDS
Gene -
Product glycine zipper 2TM domain-containing protein
Location 770469 - 770939 (strand: -1)
Length 471 (nucleotides) / 156 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1084
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05433 Glycine zipper 2TM domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3133 Cell wall/membrane/envelope biogenesis (M) M Outer membrane lipoprotein SlyB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06077 outer membrane lipoprotein SlyB - -

Protein Sequence

MYKRFLAGAFAVVALSGCVNMDTLSGDTYSAEQAKSVQTVTYATIMSARPVTIQAGGKENVLGAVGGAVLGGILGSTIGGGTGQTLATAAGAIAGGVAGQNVQGAMNNTSGVELELKQDNGEIIVVVQKQGKTPFSVGQRVRIAKSGSTYTVSPRS

Flanking regions ( +/- flanking 50bp)

CAGATAATGAACATATCCGAGTCTGTGAACATAATAATCAGGAGTTAAGTATGTATAAGCGTTTTCTCGCCGGTGCATTCGCCGTTGTCGCATTATCCGGCTGTGTGAATATGGATACACTGAGTGGTGACACTTATAGTGCAGAACAGGCGAAAAGTGTTCAAACAGTCACTTATGCTACTATTATGAGTGCCCGCCCTGTCACAATCCAGGCCGGAGGTAAGGAAAATGTTCTCGGCGCTGTGGGTGGTGCAGTTCTGGGTGGTATCTTAGGCAGCACTATCGGTGGCGGGACAGGCCAGACTCTGGCAACCGCAGCAGGTGCTATCGCCGGTGGTGTTGCAGGCCAGAACGTACAGGGTGCAATGAACAACACATCCGGTGTTGAACTGGAACTCAAACAAGACAATGGCGAGATCATTGTTGTTGTACAGAAACAAGGTAAAACACCTTTCTCTGTAGGTCAGCGCGTCCGTATCGCAAAATCAGGCTCAACGTATACCGTATCTCCGCGTTCCTGACAGCCGCTTTATCCGGCAAAAGGCGAAACAACTCTGTTTCGCCTTTTTTG