Homologs in group_1013

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05660 FBDBKF_05660 81.2 Morganella morganii S1 pdxY pyridoxal kinase PdxY
EHELCC_11930 EHELCC_11930 81.2 Morganella morganii S2 pdxY pyridoxal kinase PdxY
NLDBIP_12270 NLDBIP_12270 81.2 Morganella morganii S4 pdxY pyridoxal kinase PdxY
LHKJJB_12130 LHKJJB_12130 81.2 Morganella morganii S3 pdxY pyridoxal kinase PdxY
HKOGLL_10745 HKOGLL_10745 81.2 Morganella morganii S5 pdxY pyridoxal kinase PdxY
F4V73_RS03645 F4V73_RS03645 81.2 Morganella psychrotolerans pdxY pyridoxal kinase PdxY

Distribution of the homologs in the orthogroup group_1013

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1013

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q51892 0.0 595 98 0 289 3 pdxY Pyridoxal kinase PdxY Proteus mirabilis
Q7N3W7 2.87e-165 462 78 2 289 3 pdxY Pyridoxal kinase PdxY Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66A50 2.35e-153 432 73 2 288 3 pdxY Pyridoxal kinase PdxY Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CIM6 2.35e-152 430 73 2 288 3 pdxY Pyridoxal kinase PdxY Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIR8 2.35e-152 430 73 2 288 1 pdxY Pyridoxal kinase PdxY Yersinia pestis
Q1C792 2.35e-152 430 73 2 288 3 pdxY Pyridoxal kinase PdxY Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZPM8 3.15e-151 427 71 2 288 3 pdxY Pyridoxal kinase PdxY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57PI7 3.15e-151 427 71 2 288 3 pdxY Pyridoxal kinase PdxY Salmonella choleraesuis (strain SC-B67)
Q5PIK8 1.51e-150 425 71 2 288 3 pdxY Pyridoxal kinase PdxY Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q83KY1 3.99e-149 422 71 2 288 3 pdxY Pyridoxal kinase PdxY Shigella flexneri
Q320Z3 4.22e-149 422 71 2 288 3 pdxY Pyridoxal kinase PdxY Shigella boydii serotype 4 (strain Sb227)
P77150 4.22e-149 422 71 2 288 1 pdxY Pyridoxal kinase PdxY Escherichia coli (strain K12)
Q6D5V1 1.01e-148 421 72 3 289 3 pdxY Pyridoxal kinase PdxY Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3Z1Z2 1.71e-148 420 71 2 288 3 pdxY Pyridoxal kinase PdxY Shigella sonnei (strain Ss046)
Q1RBF9 2.35e-148 420 71 2 288 3 pdxY Pyridoxal kinase PdxY Escherichia coli (strain UTI89 / UPEC)
Q0THJ1 2.35e-148 420 71 2 288 3 pdxY Pyridoxal kinase PdxY Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FH89 3.23e-148 419 71 2 288 3 pdxY Pyridoxal kinase PdxY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X649 3.23e-148 419 71 2 288 3 pdxY Pyridoxal kinase PdxY Escherichia coli O157:H7
Q32FD7 6.36e-147 416 70 2 288 3 pdxY Pyridoxal kinase PdxY Shigella dysenteriae serotype 1 (strain Sd197)
Q5E345 5.21e-122 353 62 2 280 3 pdxY Pyridoxal kinase PdxY Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87TZ6 1.96e-117 342 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9HT57 4.13e-117 341 59 3 286 1 pdxY Pyridoxal kinase PdxY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DJ3 4.97e-117 340 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V753 6.07e-117 340 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas aeruginosa (strain LESB58)
Q8Z6Q3 1.73e-116 337 73 2 222 5 pdxY Putative pyridoxal kinase PdxY Salmonella typhi
A6VEZ4 1.91e-116 339 58 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas aeruginosa (strain PA7)
B0KR83 2.9e-116 338 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas putida (strain GB-1)
A5WB73 7.66e-116 337 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88C26 1.29e-115 337 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q48BL6 2.81e-115 336 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3K4B8 4.42e-114 333 59 3 287 3 pdxY Pyridoxal kinase PdxY Pseudomonas fluorescens (strain Pf0-1)
B1JFM7 6.76e-114 333 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas putida (strain W619)
Q4K3F6 3.76e-113 331 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C3K4G7 1.12e-112 330 58 3 287 3 pdxY Pyridoxal kinase PdxY Pseudomonas fluorescens (strain SBW25)
Q1I2L8 1.81e-112 329 59 3 286 3 pdxY Pyridoxal kinase PdxY Pseudomonas entomophila (strain L48)
Q4ZL75 8.64e-111 325 59 4 288 3 pdxY Pyridoxal kinase PdxY Pseudomonas syringae pv. syringae (strain B728a)
B3H2H2 2.37e-105 311 54 3 288 3 pdxY Pyridoxal kinase PdxY Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q65UE8 6.56e-104 307 53 3 288 3 pdxY Pyridoxal kinase PdxY Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UUD2 1.17e-103 306 54 3 288 3 pdxY Pyridoxal kinase PdxY Histophilus somni (strain 2336)
Q0I3D2 1.17e-103 306 54 3 288 3 pdxY Pyridoxal kinase PdxY Histophilus somni (strain 129Pt)
A3N2D3 3.09e-103 305 53 3 288 3 pdxY Pyridoxal kinase PdxY Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CNY1 9.3e-102 301 53 3 288 3 pdxY Pyridoxal kinase PdxY Pasteurella multocida (strain Pm70)
Q141E8 1.49e-99 296 54 4 284 1 pdxY Pyridoxal kinase PdxY Paraburkholderia xenovorans (strain LB400)
B2JCI0 5.85e-96 287 51 4 289 3 pdxY Pyridoxal kinase PdxY Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q63SC2 2.47e-95 285 51 5 286 3 pdxY Pyridoxal kinase PdxY Burkholderia pseudomallei (strain K96243)
Q2SXQ4 2.58e-95 285 51 5 286 3 pdxY Pyridoxal kinase PdxY Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q39I40 3.07e-95 285 51 5 290 3 pdxY Pyridoxal kinase PdxY Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BXQ7 5.18e-95 285 51 5 290 3 pdxY Pyridoxal kinase PdxY Burkholderia orbicola (strain AU 1054)
Q3JQA6 8.46e-95 284 51 5 286 3 pdxY Pyridoxal kinase PdxY Burkholderia pseudomallei (strain 1710b)
Q62LP6 2.26e-94 283 51 5 286 3 pdxY Pyridoxal kinase PdxY Burkholderia mallei (strain ATCC 23344)
A6VNE5 1.79e-93 281 52 3 288 3 pdxY Pyridoxal kinase PdxY Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q87FP6 2.09e-93 280 50 3 283 3 pdxY Pyridoxal kinase PdxY Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N5Q6 1.03e-91 276 49 3 283 3 pdxY Pyridoxal kinase PdxY Vibrio campbellii (strain ATCC BAA-1116)
Q7MGA4 1.77e-90 273 49 3 283 3 pdxY Pyridoxal kinase PdxY Vibrio vulnificus (strain YJ016)
Q8D4Q2 2.46e-90 273 49 3 283 3 pdxY Pyridoxal kinase PdxY Vibrio vulnificus (strain CMCP6)
A5UA83 2.8e-90 273 50 4 290 3 pdxY Pyridoxal kinase PdxY Haemophilus influenzae (strain PittEE)
P44690 4.88e-90 272 50 4 290 3 pdxY Pyridoxal kinase PdxY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6LP62 9.97e-89 269 47 3 289 3 pdxY Pyridoxal kinase PdxY Photobacterium profundum (strain SS9)
Q1AYE5 4.66e-66 211 44 5 283 3 pdxY Pyridoxal kinase PdxY Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1J237 9.19e-66 210 40 4 291 3 pdxY Pyridoxal kinase PdxY Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q6NG19 4.46e-65 208 37 3 286 3 pdxY Pyridoxal kinase PdxY Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q9RYX0 3.1e-63 204 41 4 291 3 pdxY Pyridoxal kinase PdxY Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6AFC1 8.75e-63 202 40 5 291 3 pdxY Pyridoxal kinase PdxY Leifsonia xyli subsp. xyli (strain CTCB07)
Q0BSF0 5.1e-60 195 40 5 289 3 pdxY Pyridoxal kinase PdxY Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q0II59 2.1e-37 137 34 7 267 2 PDXK Pyridoxal kinase Bos taurus
P82197 2.89e-37 137 34 7 267 1 PDXK Pyridoxal kinase Ovis aries
O46560 3.92e-34 129 33 7 267 1 PDXK Pyridoxal kinase Sus scrofa
Q1PCB1 4.88e-34 128 33 7 259 1 Pdxk Pyridoxal kinase Bombyx mori
O00764 5.77e-34 128 31 7 267 1 PDXK Pyridoxal kinase Homo sapiens
O35331 1.36e-33 127 33 7 268 1 Pdxk Pyridoxal kinase Rattus norvegicus
Q8W1X2 9.18e-33 125 33 6 234 1 PK Pyridoxal kinase Arabidopsis thaliana
Q8K183 2.59e-32 124 32 7 268 1 Pdxk Pyridoxal kinase Mus musculus
O01824 6.48e-29 115 29 11 302 3 pdxk-1 Putative pyridoxal kinase Caenorhabditis elegans
B7LL66 6.64e-28 112 29 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NPV5 1.8e-27 110 29 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P40191 3.5e-27 110 29 4 267 1 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain K12)
B1IX53 3.5e-27 110 29 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2R4 3.5e-27 110 29 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O9:H4 (strain HS)
B1XA89 3.5e-27 110 29 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain K12 / DH10B)
C4ZVU9 3.5e-27 110 29 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain K12 / MC4100 / BW2952)
B7N609 3.88e-27 109 29 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5YZW5 7.54e-27 108 30 5 269 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBL0 7.54e-27 108 30 5 269 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O157:H7
O14242 1.31e-26 108 29 9 309 3 SPAC6F6.11c Putative pyridoxal kinase C6F6.11c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3YZC3 1.42e-26 108 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella sonnei (strain Ss046)
B6I4Z5 1.42e-26 108 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain SE11)
B7M6S8 1.42e-26 108 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O8 (strain IAI1)
B7UGB9 1.42e-26 108 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPL9 1.42e-26 108 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
B2TX08 2.11e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q83K78 2.17e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella flexneri
Q1R8V2 2.43e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain UTI89 / UPEC)
Q8FFB5 2.43e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TF48 2.43e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ADT5 2.43e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O1:K1 / APEC
B7MY71 2.43e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O81 (strain ED1a)
B7MHS2 2.43e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q32DD5 2.93e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella dysenteriae serotype 1 (strain Sd197)
B7LCG3 3.15e-26 107 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain 55989 / EAEC)
Q1LFU5 5.14e-26 107 30 3 257 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q55EK9 5.95e-26 107 34 3 182 1 pykA Pyridoxal kinase Dictyostelium discoideum
B1LML3 2.85e-25 104 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain SMS-3-5 / SECEC)
P39988 7.82e-24 101 30 9 301 1 BUD16 Putative pyridoxal kinase BUD16 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P53727 8.05e-24 101 31 10 274 1 BUD17 Putative pyridoxal kinase BUD17 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7W6K7 1.61e-21 94 29 3 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WII1 1.61e-21 94 29 3 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5PNC8 1.02e-20 92 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P40192 8.19e-20 90 28 4 267 2 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57LS3 8.19e-20 90 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Salmonella choleraesuis (strain SC-B67)
Q7VYK4 2.44e-19 89 29 3 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2L1P5 5.74e-19 88 29 3 255 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Bordetella avium (strain 197N)
Q8Z4W1 1.59e-18 86 28 4 267 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Salmonella typhi
O74860 9.32e-11 65 26 7 237 3 SPCC18.10 Putative pyridoxal kinase C18.10 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O48881 1.63e-07 55 28 4 176 1 BTH1 Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic Brassica napus
P39610 9.35e-07 52 24 5 200 1 pdxK Pyridoxine kinase Bacillus subtilis (strain 168)
P44697 7.66e-06 50 27 4 175 3 thiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5M731 8.08e-06 50 32 1 109 1 TH1 Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic Arabidopsis thaliana
O31620 2.25e-05 48 32 3 117 1 thiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase Bacillus subtilis (strain 168)
Q5HI96 3.92e-05 47 27 1 107 3 pdxK Putative pyridoxine kinase Staphylococcus aureus (strain COL)
Q8FTH8 0.000197 46 30 4 139 3 thiED Thiamine biosynthesis multifunctional protein ThiED Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
O83153 0.000557 44 28 1 111 3 pdxK Putative pyridoxine kinase Treponema pallidum (strain Nichols)
Q2QWK9 0.000875 44 30 1 107 2 Os12g0192500 Probable thiamine biosynthetic bifunctional enzyme, chloroplastic Oryza sativa subsp. japonica

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06690
Feature type CDS
Gene pdxY
Product pyridoxal kinase PdxY
Location 1463166 - 1464035 (strand: -1)
Length 870 (nucleotides) / 289 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1013
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08543 Phosphomethylpyrimidine kinase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2240 Coenzyme transport and metabolism (H) H Pyridoxal/pyridoxine/pyridoxamine kinase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00868 pyridoxine kinase [EC:2.7.1.35] Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of cofactors		 -

Protein Sequence

MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQYPEKWTGCVMSAEHITEIVDGIAAIGKLAQCDAVLSGYLGSAEQGRRIVDIVKKVKQANPNAWYFCDPVMGHPEKGCIVPPEVSGVLCEDALPISDIIAPNLLELETLAGGATLHNVDQCVKAARQLCQQGPKIVLVKHLSRAGFRHDRFEMLLVTADHSWHVSRPLVDFGERQPVGVGDLTSGLMLVDLLKGVELKTALEHVAAAVYEVMLKTKEMNEYELQLVAAQDQMVHPTHNFCATQLD

Flanking regions ( +/- flanking 50bp)

TGATAATAAAGCTTGGGTGTTGTGTGTATTCACAATAATCGGTTTATGTCATGAAAAATATACTCTCTATTCAATCTCATGTAGTTTTTGGTCACGCAGGTAATAGCGCTGCTGAATTTCCAATGCGCCGTATGGGGGTAAATGTTTGGCCTTTAAATACGGTTCAATTTTCCAACCACACACAATATCCAGAAAAATGGACGGGTTGTGTGATGTCGGCAGAGCATATCACTGAGATCGTTGATGGTATCGCTGCTATTGGTAAATTAGCACAGTGTGATGCGGTATTAAGTGGTTATCTTGGCTCGGCAGAGCAAGGCCGACGCATTGTTGATATTGTAAAAAAAGTCAAACAAGCTAATCCTAACGCATGGTACTTTTGTGATCCGGTTATGGGACATCCTGAAAAAGGTTGTATTGTGCCTCCAGAAGTTTCTGGCGTACTTTGTGAAGATGCTTTGCCCATCAGTGATATTATTGCACCCAACTTATTAGAACTTGAAACATTAGCTGGTGGAGCAACGCTGCATAATGTTGACCAATGTGTAAAAGCGGCCCGTCAATTATGCCAGCAAGGGCCTAAAATTGTATTAGTAAAACATTTATCACGAGCAGGCTTTCGTCATGATCGCTTTGAAATGTTACTGGTGACTGCAGATCACAGTTGGCACGTGAGCCGACCGCTGGTTGATTTTGGTGAACGTCAGCCTGTTGGTGTCGGGGATCTAACCAGTGGTTTAATGCTGGTGGATTTACTAAAAGGTGTTGAGCTAAAAACGGCATTAGAGCATGTTGCTGCTGCTGTTTATGAAGTGATGTTAAAAACTAAAGAGATGAATGAGTACGAGTTACAACTCGTCGCCGCTCAAGATCAAATGGTGCACCCAACCCATAACTTCTGTGCAACGCAGTTAGATTAATCATATTGTTAATATAAAGCGGAAGTCATTAATTTCCGCTTTTTATGTTT