Homologs in group_3686

Help

2 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS11095 F4V73_RS11095 50.0 Morganella psychrotolerans - PAAR domain-containing protein
F4V73_RS16800 F4V73_RS16800 49.4 Morganella psychrotolerans - PAAR domain-containing protein

Distribution of the homologs in the orthogroup group_3686

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3686

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06425
Feature type CDS
Gene -
Product PAAR domain-containing protein
Location 1409271 - 1409543 (strand: -1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3686
Orthogroup size 3
N. genomes 2

Actions

Genomic region

Domains

PF05488 PAAR motif

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4104 Intracellular trafficking, secretion, and vesicular transport (U) U Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion

Protein Sequence

MRATVLGKKIGLHNDKTTTGATCLASILTVTNEGISILRLGDKTTRCPVCNEEGTIVTGEQGMILDGQKIAVEGSIVQCGCSYGKNRVTC

Flanking regions ( +/- flanking 50bp)

TTGATACTGCGTAGCGATCTTTATAGCTTCATATATGTAAGGAAACAATGATGAGAGCCACAGTCCTTGGGAAAAAAATTGGATTACATAATGACAAAACGACCACCGGAGCGACTTGTCTTGCTAGCATATTAACGGTCACCAATGAAGGGATTAGCATATTGAGGCTTGGAGATAAAACAACACGTTGTCCAGTATGCAATGAAGAAGGCACGATAGTGACTGGAGAGCAAGGAATGATACTGGATGGACAAAAAATTGCTGTAGAAGGCTCTATTGTCCAATGTGGCTGCTCTTATGGAAAGAATAGAGTTACTTGTTAAATTTTTTCTTATTATTCGCAAGGAGAAATAGTCATGGATGGATTAGTTTT