Homologs in group_628

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02025 FBDBKF_02025 71.9 Morganella morganii S1 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
EHELCC_02495 EHELCC_02495 71.9 Morganella morganii S2 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
NLDBIP_00965 NLDBIP_00965 71.9 Morganella morganii S4 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
LHKJJB_01070 LHKJJB_01070 71.9 Morganella morganii S3 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
HKOGLL_01110 HKOGLL_01110 71.9 Morganella morganii S5 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
F4V73_RS04390 F4V73_RS04390 72.8 Morganella psychrotolerans cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

Distribution of the homologs in the orthogroup group_628

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_628

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETP0 0.0 672 100 0 324 3 cmoB tRNA U34 carboxymethyltransferase Proteus mirabilis (strain HI4320)
Q7N556 0.0 533 76 1 324 3 cmoB tRNA U34 carboxymethyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TB40 2.4e-176 494 72 1 324 3 cmoB tRNA U34 carboxymethyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XPZ5 2.48e-176 494 72 1 324 3 cmoB tRNA U34 carboxymethyltransferase Klebsiella pneumoniae (strain 342)
A4TJK9 5.44e-175 490 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis (strain Pestoides F)
Q1CJH4 5.44e-175 490 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYY2 5.44e-175 490 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q7CIB6 5.44e-175 490 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis
Q1C824 5.44e-175 490 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
B1JLL9 6e-175 490 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FID4 2.52e-174 488 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JRM4 2.91e-174 488 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q66AU8 5.25e-174 488 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K315 5.25e-174 488 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4WBM8 1.75e-172 484 71 1 324 3 cmoB tRNA U34 carboxymethyltransferase Enterobacter sp. (strain 638)
B2VJC1 6.25e-172 482 71 2 323 3 cmoB tRNA U34 carboxymethyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GFJ8 1.1e-170 479 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Serratia proteamaculans (strain 568)
B6I1E9 1.76e-170 479 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain SE11)
Q3Z2P7 6.05e-170 477 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella sonnei (strain Ss046)
B7M2G2 6.05e-170 477 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O8 (strain IAI1)
B7L7S4 6.05e-170 477 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain 55989 / EAEC)
Q0T3Q7 6.12e-170 477 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella flexneri serotype 5b (strain 8401)
Q322J0 1.22e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella boydii serotype 4 (strain Sb227)
B2U4X2 1.22e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YR16 2.25e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCH5 2.25e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O157:H7
B1LD00 2.33e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B1J0L7 2.33e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A172 2.33e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O9:H4 (strain HS)
B7NS47 2.33e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A7ZMZ6 3.2e-169 476 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
C6DFE2 4.77e-169 475 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D482 5.91e-169 475 71 1 324 3 cmoB tRNA U34 carboxymethyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Z5W0 6.88e-169 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella typhi
B5FSM5 7.43e-169 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella dublin (strain CT_02021853)
B5F3I4 7.43e-169 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella agona (strain SL483)
Q8ZNV1 9.25e-169 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1RAR3 1.01e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain UTI89 / UPEC)
B7NBM2 1.01e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P76291 1.01e-168 474 70 1 324 1 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain K12)
A1AC32 1.01e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O1:K1 / APEC
B1XHD9 1.01e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQF5 1.01e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MBT0 1.01e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7USP8 1.01e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7MW65 1.16e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O81 (strain ED1a)
C0Q2E3 1.19e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi C (strain RKS4594)
A9MUB3 1.29e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57N91 1.29e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella choleraesuis (strain SC-B67)
B7LPH3 1.29e-168 474 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q83R57 1.5e-168 474 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella flexneri
Q8FGQ5 2.17e-168 473 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGW1 2.17e-168 473 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B4SVF6 2.25e-168 473 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella newport (strain SL254)
B4T804 2.25e-168 473 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella heidelberg (strain SL476)
B5R145 2.25e-168 473 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella enteritidis PT4 (strain P125109)
B4TYS9 3.37e-168 473 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella schwarzengrund (strain CVM19633)
A9MNC7 6.86e-168 472 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AFH0 8.33e-168 472 70 2 324 3 cmoB tRNA U34 carboxymethyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5R8D1 9.12e-168 472 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
A7MEB0 1.56e-167 471 68 1 324 3 cmoB tRNA U34 carboxymethyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
C5B836 3.4e-167 470 68 1 324 3 cmoB tRNA U34 carboxymethyltransferase Edwardsiella ictaluri (strain 93-146)
Q32H78 6.41e-167 470 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B5BH49 1.41e-166 469 69 1 323 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PMY9 1.41e-166 469 69 1 323 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7N1I8 1.83e-162 458 67 3 325 3 cmoB tRNA U34 carboxymethyltransferase Vibrio campbellii (strain ATCC BAA-1116)
C3LLK9 5.01e-162 457 67 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSU3 5.01e-162 457 67 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F277 5.01e-162 457 67 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q2NTJ8 1.55e-161 456 67 1 323 3 cmoB tRNA U34 carboxymethyltransferase Sodalis glossinidius (strain morsitans)
Q87QV5 2.05e-161 456 67 3 325 3 cmoB tRNA U34 carboxymethyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VMH7 1.43e-160 454 66 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio atlanticus (strain LGP32)
Q7MJ71 3.58e-160 452 66 3 325 3 cmoB tRNA U34 carboxymethyltransferase Vibrio vulnificus (strain YJ016)
Q8DAP0 3.58e-160 452 66 3 325 1 cmoB tRNA U34 carboxymethyltransferase Vibrio vulnificus (strain CMCP6)
Q5E6A4 2.03e-157 446 66 1 324 3 cmoB tRNA U34 carboxymethyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B8F571 2.12e-157 446 68 3 322 3 cmoB tRNA U34 carboxymethyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
B5FCP7 1e-156 444 65 1 324 3 cmoB tRNA U34 carboxymethyltransferase Aliivibrio fischeri (strain MJ11)
B6EGI9 1.39e-155 441 65 1 324 3 cmoB tRNA U34 carboxymethyltransferase Aliivibrio salmonicida (strain LFI1238)
P44167 1.14e-154 439 64 2 323 1 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4SPN8 2.1e-154 438 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Aeromonas salmonicida (strain A449)
Q6LT56 5.13e-154 437 63 1 324 3 cmoB tRNA U34 carboxymethyltransferase Photobacterium profundum (strain SS9)
A5UBW0 1.11e-153 436 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain PittEE)
A5UEI8 2.21e-153 435 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain PittGG)
B3H1F1 3.33e-153 435 66 3 322 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BP95 3.6e-153 435 66 3 322 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N0H4 3.6e-153 435 66 3 322 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65UH7 4.54e-153 434 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q4QK61 9.67e-153 434 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain 86-028NP)
A6VMT0 1.46e-152 433 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A0KIF5 1.58e-152 433 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9CNT5 7.99e-152 431 65 2 323 3 cmoB tRNA U34 carboxymethyltransferase Pasteurella multocida (strain Pm70)
A1SST4 4.34e-151 430 62 1 323 3 cmoB tRNA U34 carboxymethyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0I1M1 3.72e-150 427 63 2 323 3 cmoB tRNA U34 carboxymethyltransferase Histophilus somni (strain 129Pt)
B0UVK6 4.01e-150 427 63 2 323 3 cmoB tRNA U34 carboxymethyltransferase Histophilus somni (strain 2336)
C4LBH9 1.32e-148 423 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B1KHH0 5.89e-148 422 62 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
Q8EEE6 6.36e-148 422 62 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3QEQ0 4.41e-147 420 62 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HUY4 2.86e-146 417 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain MR-7)
Q0HIZ8 4.58e-146 417 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain MR-4)
A0KWL2 4.58e-146 417 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain ANA-3)
A3D474 4.59e-146 417 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9L3I4 4.64e-146 417 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS195)
A6WNQ9 4.64e-146 417 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS185)
B8EA68 4.64e-146 417 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS223)
A4Y6S2 1.3e-145 416 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8FUW3 4.22e-145 415 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sediminis (strain HAW-EB3)
A1RJQ9 7.16e-145 414 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain W3-18-1)
Q7VL50 2.56e-144 412 62 3 322 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0TSA0 1.36e-143 411 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella halifaxensis (strain HAW-EB4)
A8H552 2.27e-142 408 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q3IIQ3 3.53e-142 407 60 2 318 3 cmoB tRNA U34 carboxymethyltransferase Pseudoalteromonas translucida (strain TAC 125)
B8CNX4 3.96e-142 407 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
A1S6P5 7.07e-142 407 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q483D0 7.5e-142 406 58 3 323 3 cmoB tRNA U34 carboxymethyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q081N2 7.89e-142 406 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella frigidimarina (strain NCIMB 400)
Q12N03 1.53e-140 403 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C4K5W3 8.72e-136 391 58 2 325 3 cmoB tRNA U34 carboxymethyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q15NL3 1.46e-134 388 57 2 320 3 cmoB tRNA U34 carboxymethyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B4S0J9 3.46e-132 382 56 1 314 3 cmoB tRNA U34 carboxymethyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q5R0Q5 1.56e-127 370 56 3 323 3 cmoB tRNA U34 carboxymethyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1QUG3 1.59e-118 347 55 2 314 3 cmoB tRNA U34 carboxymethyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2SJW1 1.53e-117 345 54 4 326 3 cmoB tRNA U34 carboxymethyltransferase Hahella chejuensis (strain KCTC 2396)
Q3K7D4 5.55e-115 338 52 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q31JJ8 1.01e-114 338 52 3 326 3 cmoB tRNA U34 carboxymethyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C6E229 1.92e-114 337 51 4 326 3 cmoB tRNA U34 carboxymethyltransferase Geobacter sp. (strain M21)
B5EIQ6 2.07e-114 337 50 4 327 3 cmoB tRNA U34 carboxymethyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C3K6Z3 2.95e-114 336 53 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas fluorescens (strain SBW25)
Q4K6X6 3.55e-114 336 52 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5W8E5 4.66e-114 335 54 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C1DQS9 1.32e-113 334 54 6 325 3 cmoB tRNA U34 carboxymethyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q88MX8 1.97e-113 334 54 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1I5M7 4.66e-113 333 54 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas entomophila (strain L48)
Q21JL7 6.57e-113 333 49 2 325 3 cmoB tRNA U34 carboxymethyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B1J4E4 2.19e-112 331 52 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain W619)
Q0VQX6 4.37e-112 330 57 4 289 3 cmoB tRNA U34 carboxymethyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4XSD0 4.52e-112 330 55 5 309 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas mendocina (strain ymp)
B0KV20 9.99e-112 330 53 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain GB-1)
A1U4B9 3.45e-111 328 53 3 308 3 cmoB tRNA U34 carboxymethyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9I5G4 4.51e-111 328 51 7 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02HS6 2.85e-110 326 51 7 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYW8 2.85e-110 326 51 7 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain LESB58)
A6VAK2 9.77e-110 325 51 8 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain PA7)
A5WC55 2.31e-109 325 52 4 326 3 cmoB tRNA U34 carboxymethyltransferase Psychrobacter sp. (strain PRwf-1)
Q48EV7 2.46e-109 323 51 7 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4VIY1 4.03e-109 323 56 5 289 3 cmoB tRNA U34 carboxymethyltransferase Stutzerimonas stutzeri (strain A1501)
Q4ZPE5 5.64e-109 323 51 7 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q39SM2 8.28e-109 322 50 4 324 3 cmoB tRNA U34 carboxymethyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B3PFU1 1.38e-108 322 50 2 321 3 cmoB tRNA U34 carboxymethyltransferase Cellvibrio japonicus (strain Ueda107)
Q87XG5 4.19e-108 320 51 6 325 1 cmoB tRNA U34 carboxymethyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4FQB2 6.55e-108 321 52 4 329 3 cmoB tRNA U34 carboxymethyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B3E6X8 8.82e-108 320 50 2 306 3 cmoB tRNA U34 carboxymethyltransferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q1Q8I5 1.55e-107 320 50 4 342 3 cmoB tRNA U34 carboxymethyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q603L5 8.22e-101 302 49 3 307 3 cmoB tRNA U34 carboxymethyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3A8E9 3.58e-88 270 46 3 280 3 cmoB tRNA U34 carboxymethyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C0QJG7 2.42e-82 255 44 4 291 3 cmoB tRNA U34 carboxymethyltransferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A1AVT4 1.24e-80 250 39 5 329 3 cmoB tRNA U34 carboxymethyltransferase Ruthia magnifica subsp. Calyptogena magnifica
A5EVQ5 2.76e-74 234 43 6 288 3 cmoB tRNA U34 carboxymethyltransferase Dichelobacter nodosus (strain VCS1703A)
B9L8G5 3.22e-70 223 48 5 241 3 cmoB tRNA U34 carboxymethyltransferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
A8EUD5 1.98e-69 221 40 5 285 3 cmoB tRNA U34 carboxymethyltransferase Aliarcobacter butzleri (strain RM4018)
A7ZEA2 9.31e-69 219 41 5 272 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter concisus (strain 13826)
Q10V92 4.32e-68 218 38 4 286 3 cmoB tRNA U34 carboxymethyltransferase Trichodesmium erythraeum (strain IMS101)
A6Q7V3 1.08e-67 217 38 5 304 3 cmoB tRNA U34 carboxymethyltransferase Sulfurovum sp. (strain NBC37-1)
Q6AIL0 1.13e-67 217 40 5 278 3 cmoB tRNA U34 carboxymethyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B5Z809 7.18e-67 213 45 2 241 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain G27)
Q17Y58 1.34e-66 213 45 2 243 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter acinonychis (strain Sheeba)
B2UUE3 4.14e-66 211 45 2 241 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain Shi470)
Q9ZKH1 5.04e-66 211 45 2 241 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
Q1CSN0 9.43e-66 210 45 2 241 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain HPAG1)
O25173 9.96e-66 210 45 2 241 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q30SA5 1.71e-65 211 41 3 242 3 cmoB tRNA U34 carboxymethyltransferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B6JMM9 7.13e-65 208 45 2 241 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain P12)
A6Q3V1 8.11e-65 209 38 3 275 3 cmoB tRNA U34 carboxymethyltransferase Nitratiruptor sp. (strain SB155-2)
Q7MS89 7.85e-64 206 39 3 278 3 cmoB tRNA U34 carboxymethyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A7I1I7 2.01e-63 205 43 3 232 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A0RPV3 1.92e-61 200 41 3 240 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter fetus subsp. fetus (strain 82-40)
A7GXW7 4.34e-61 199 41 3 246 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter curvus (strain 525.92)
Q7VGI1 5.34e-61 200 36 7 280 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A1VZW5 2.58e-58 192 37 3 265 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A7H361 3.64e-58 192 37 3 265 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q5HUI4 4.01e-58 192 37 3 265 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni (strain RM1221)
Q0P9S6 4.37e-58 192 37 3 265 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FM27 1.24e-57 191 37 3 263 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B9KFR5 2.24e-54 182 37 2 239 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q16D32 2.36e-06 51 34 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A8LQ43 2.69e-06 51 31 4 139 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
P44074 2.99e-05 48 31 2 114 4 HI_0912 Uncharacterized protein HI_0912 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4WW91 4.36e-05 47 30 4 139 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A4YKT6 6.01e-05 47 29 3 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium sp. (strain ORS 278)
A1TSA0 6.43e-05 47 31 4 130 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paracidovorax citrulli (strain AAC00-1)
B9KPP7 7.98e-05 47 28 4 139 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IYM5 0.000112 46 28 4 139 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q1GCH8 0.000118 46 31 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria sp. (strain TM1040)
B3QCF3 0.000136 46 29 3 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain TIE-1)
Q6NC69 0.000136 46 29 3 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A3PNM3 0.000141 46 28 4 139 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q28VP7 0.000142 46 32 5 130 3 ubiG Ubiquinone biosynthesis O-methyltransferase Jannaschia sp. (strain CCS1)
A0A0A2IBN3 0.000154 46 28 5 166 1 cnsE O-methyltransferase cnsE Penicillium expansum
Q1QEI9 0.000263 45 32 2 125 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FVG3 0.000315 45 32 4 128 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q2J419 0.000399 45 28 3 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain HaA2)
Q13EZ9 0.000505 44 27 3 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisB5)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05375
Feature type CDS
Gene cmoB
Product tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
Location 1177186 - 1178160 (strand: -1)
Length 975 (nucleotides) / 324 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_628
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08003 Protein of unknown function (DUF1698)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2227 Coenzyme transport and metabolism (H) H 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15257 tRNA (mo5U34)-methyltransferase [EC:2.1.1.-] - -

Protein Sequence

MINFSSFYQHIAQDERLFHWLDTLPAQLSEWRAHALHGHFASWERMLENLPEITPTELNLKQGVIANKTPALSTGEQLGLTNILKALMPWRKGPFSLYGVNIDTEWRSDWKWDRVLPHLSPLKGRLVLDVGCGSGYHMWRMLGEGADFVVGIDPTQLFLCQFEAVRKLLGNDQRAHLIPVGIEQMPELNAFDTVFSMGVLYHRRSPLDHLWQLKNQLVSGGELVLESLVIDGDEFQCLIPGERYAQMRNVYFIPSAKMLKVWLEKCGFKDVRIVDENVTSLEEQRKTDWMVTDSLEAFLDPLDHTKTVEGYPAPKRAILIATKP

Flanking regions ( +/- flanking 50bp)

TTCCAATGTTTTAATTTTGGCTCTCTGTTAGCCATTAAAGGCGAATAATCATGATAAATTTTAGCTCATTTTATCAACATATTGCGCAAGATGAACGGTTATTTCATTGGCTTGATACGCTGCCGGCACAATTATCAGAATGGCGCGCCCATGCTTTACATGGCCATTTTGCTTCATGGGAAAGAATGCTGGAAAACTTACCTGAGATTACTCCCACTGAACTTAATTTAAAGCAAGGTGTTATCGCCAATAAAACCCCAGCATTAAGTACCGGTGAACAACTTGGTTTAACGAATATTCTAAAAGCGTTAATGCCATGGCGCAAAGGCCCTTTTTCTCTTTATGGTGTCAATATTGATACTGAATGGCGTTCAGATTGGAAATGGGATCGCGTATTGCCCCATCTTTCGCCTCTTAAAGGCCGATTAGTTTTAGATGTTGGTTGTGGTAGTGGTTATCATATGTGGCGGATGCTTGGTGAAGGGGCTGATTTTGTTGTCGGTATCGATCCCACTCAGCTCTTTTTATGCCAATTTGAAGCAGTCAGAAAATTATTAGGTAACGATCAGCGTGCCCATTTAATCCCTGTCGGCATTGAACAAATGCCAGAACTAAATGCTTTTGATACGGTATTTTCAATGGGGGTTCTTTACCACCGTCGTTCACCACTTGATCATCTTTGGCAATTGAAAAATCAGCTCGTTTCTGGTGGTGAATTAGTATTAGAGAGTCTTGTGATTGATGGTGATGAATTCCAATGTTTAATTCCTGGTGAGCGTTATGCACAGATGCGTAATGTGTACTTTATACCGTCAGCCAAAATGCTCAAAGTATGGTTAGAAAAATGCGGTTTTAAAGATGTACGCATTGTTGATGAAAATGTCACATCACTCGAAGAGCAACGTAAAACGGATTGGATGGTGACTGATTCATTAGAAGCATTCTTAGATCCTCTCGATCACACCAAAACCGTTGAAGGCTATCCAGCTCCTAAACGGGCAATTTTAATTGCGACTAAACCTTAATTAACCACGAGTCATTTCTATAAAAAGGGTATTTATCAATAATACCCTTT