Homologs in group_628

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02025 FBDBKF_02025 100.0 Morganella morganii S1 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
EHELCC_02495 EHELCC_02495 100.0 Morganella morganii S2 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
NLDBIP_00965 NLDBIP_00965 100.0 Morganella morganii S4 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
LHKJJB_01070 LHKJJB_01070 100.0 Morganella morganii S3 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
F4V73_RS04390 F4V73_RS04390 87.3 Morganella psychrotolerans cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
PMI_RS05375 PMI_RS05375 71.9 Proteus mirabilis HI4320 cmoB tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB

Distribution of the homologs in the orthogroup group_628

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_628

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N556 0.0 526 75 1 324 3 cmoB tRNA U34 carboxymethyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4TYS9 0.0 511 75 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella schwarzengrund (strain CVM19633)
B4SVF6 0.0 511 75 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella newport (strain SL254)
B4T804 0.0 511 75 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella heidelberg (strain SL476)
B5R145 0.0 511 75 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella enteritidis PT4 (strain P125109)
Q0T3Q7 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella flexneri serotype 5b (strain 8401)
Q8ZNV1 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0Q2E3 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi C (strain RKS4594)
A9MUB3 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57N91 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella choleraesuis (strain SC-B67)
B1LD00 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B1J0L7 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A172 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O9:H4 (strain HS)
B7NS47 0.0 511 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5R8D1 0.0 510 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5FSM5 0.0 510 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella dublin (strain CT_02021853)
B5F3I4 0.0 510 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella agona (strain SL483)
B5YR16 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCH5 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O157:H7
Q3Z2P7 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella sonnei (strain Ss046)
Q8Z5W0 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella typhi
B7M2G2 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O8 (strain IAI1)
B7L7S4 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZMZ6 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q322J0 0.0 509 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella boydii serotype 4 (strain Sb227)
B2U4X2 0.0 509 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RAR3 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain UTI89 / UPEC)
B7NBM2 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P76291 0.0 509 74 1 324 1 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain K12)
A1AC32 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O1:K1 / APEC
B1XHD9 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQF5 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MW65 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O81 (strain ED1a)
B7MBT0 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7USP8 0.0 509 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B4ETP0 0.0 508 71 0 324 3 cmoB tRNA U34 carboxymethyltransferase Proteus mirabilis (strain HI4320)
B6I1E9 0.0 508 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli (strain SE11)
B5XPZ5 0.0 508 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Klebsiella pneumoniae (strain 342)
Q8FGQ5 0.0 508 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGW1 0.0 508 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A6TB40 0.0 508 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q83R57 0.0 507 74 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella flexneri
B7LPH3 0.0 507 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q32H78 1.07e-180 504 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
A4WBM8 1.92e-180 504 72 1 324 3 cmoB tRNA U34 carboxymethyltransferase Enterobacter sp. (strain 638)
B5BH49 2.85e-180 503 73 1 323 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PMY9 2.85e-180 503 73 1 323 3 cmoB tRNA U34 carboxymethyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MNC7 1.12e-179 502 73 1 324 3 cmoB tRNA U34 carboxymethyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7MEB0 5.18e-178 498 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
A8AFH0 1.67e-177 496 73 2 324 3 cmoB tRNA U34 carboxymethyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VJC1 1.54e-176 494 72 2 323 3 cmoB tRNA U34 carboxymethyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JRM4 6e-175 490 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JLL9 5.73e-174 488 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FID4 1.77e-173 486 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TJK9 1.81e-173 486 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis (strain Pestoides F)
Q1CJH4 1.81e-173 486 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYY2 1.81e-173 486 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q7CIB6 1.81e-173 486 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis
Q1C824 1.81e-173 486 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
Q66AU8 4.85e-173 485 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K315 4.85e-173 485 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A8GFJ8 7.85e-173 484 68 1 324 3 cmoB tRNA U34 carboxymethyltransferase Serratia proteamaculans (strain 568)
C5B836 4.81e-170 478 69 1 324 3 cmoB tRNA U34 carboxymethyltransferase Edwardsiella ictaluri (strain 93-146)
Q2NTJ8 1.66e-169 476 69 1 323 3 cmoB tRNA U34 carboxymethyltransferase Sodalis glossinidius (strain morsitans)
C6DFE2 2.9e-168 473 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D482 6.32e-166 467 70 1 324 3 cmoB tRNA U34 carboxymethyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4SPN8 3.08e-162 458 63 1 323 3 cmoB tRNA U34 carboxymethyltransferase Aeromonas salmonicida (strain A449)
A0KIF5 1.32e-159 451 62 1 323 3 cmoB tRNA U34 carboxymethyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87QV5 6.3e-159 449 63 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MJ71 5.56e-158 447 62 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio vulnificus (strain YJ016)
Q8DAP0 5.56e-158 447 62 1 324 1 cmoB tRNA U34 carboxymethyltransferase Vibrio vulnificus (strain CMCP6)
A7N1I8 6.85e-158 447 62 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio campbellii (strain ATCC BAA-1116)
C3LLK9 4.15e-156 442 61 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSU3 4.15e-156 442 61 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F277 4.15e-156 442 61 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P44167 5.23e-155 439 63 2 323 1 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBW0 5.34e-155 439 63 2 323 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain PittEE)
Q6LT56 9.41e-155 439 60 1 324 3 cmoB tRNA U34 carboxymethyltransferase Photobacterium profundum (strain SS9)
A6VMT0 2.76e-154 437 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65UH7 2.82e-154 437 63 2 323 3 cmoB tRNA U34 carboxymethyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5UEI8 3.08e-154 437 63 2 323 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain PittGG)
B7VMH7 3.16e-154 437 61 1 324 3 cmoB tRNA U34 carboxymethyltransferase Vibrio atlanticus (strain LGP32)
Q4QK61 7.8e-154 436 63 2 323 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus influenzae (strain 86-028NP)
C4LBH9 5.98e-153 434 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q5E6A4 6.09e-153 434 60 1 324 3 cmoB tRNA U34 carboxymethyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0I1M1 6.45e-153 434 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Histophilus somni (strain 129Pt)
B0UVK6 7.19e-153 434 64 2 323 3 cmoB tRNA U34 carboxymethyltransferase Histophilus somni (strain 2336)
B8F571 2.12e-152 433 64 3 321 3 cmoB tRNA U34 carboxymethyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
A1SST4 2.19e-152 433 61 1 323 3 cmoB tRNA U34 carboxymethyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B5FCP7 3.04e-152 432 60 1 324 3 cmoB tRNA U34 carboxymethyltransferase Aliivibrio fischeri (strain MJ11)
B6EGI9 5.14e-152 432 62 1 324 3 cmoB tRNA U34 carboxymethyltransferase Aliivibrio salmonicida (strain LFI1238)
B3H1F1 3.98e-151 429 63 3 321 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BP95 7.26e-151 429 63 3 321 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N0H4 7.26e-151 429 63 3 321 3 cmoB tRNA U34 carboxymethyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B1KHH0 4.34e-148 422 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
Q9CNT5 5.52e-148 422 61 2 323 3 cmoB tRNA U34 carboxymethyltransferase Pasteurella multocida (strain Pm70)
B0TSA0 7.49e-148 422 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella halifaxensis (strain HAW-EB4)
A8H552 3.24e-147 420 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8FUW3 3.54e-147 420 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sediminis (strain HAW-EB3)
A3QEQ0 2.02e-146 418 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EEE6 1.07e-145 416 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8CNX4 1.17e-145 416 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q0HIZ8 3.5e-145 415 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain MR-4)
A0KWL2 3.5e-145 415 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain ANA-3)
Q0HUY4 8.3e-145 414 60 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain MR-7)
A9L3I4 3.78e-143 410 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS195)
A6WNQ9 3.78e-143 410 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS185)
B8EA68 3.78e-143 410 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS223)
A3D474 3.82e-143 410 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A4Y6S2 1.64e-142 408 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q12N03 2.48e-142 408 58 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q3IIQ3 2.63e-142 407 58 2 319 3 cmoB tRNA U34 carboxymethyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q081N2 8.9e-142 406 58 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella frigidimarina (strain NCIMB 400)
A1RJQ9 1.09e-141 406 59 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella sp. (strain W3-18-1)
A1S6P5 1.28e-140 403 58 1 323 3 cmoB tRNA U34 carboxymethyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7VL50 2.91e-140 402 60 3 321 3 cmoB tRNA U34 carboxymethyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q483D0 6.86e-140 401 55 3 322 3 cmoB tRNA U34 carboxymethyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C4K5W3 4.59e-132 381 54 2 325 3 cmoB tRNA U34 carboxymethyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B4S0J9 1.47e-129 375 55 1 311 3 cmoB tRNA U34 carboxymethyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q15NL3 3.4e-129 374 55 2 320 3 cmoB tRNA U34 carboxymethyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1QUG3 1.31e-121 355 56 4 312 3 cmoB tRNA U34 carboxymethyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5R0Q5 5.77e-119 348 52 3 323 3 cmoB tRNA U34 carboxymethyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q21JL7 2.42e-117 344 51 2 325 3 cmoB tRNA U34 carboxymethyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1U4B9 3.05e-116 342 55 3 309 3 cmoB tRNA U34 carboxymethyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q31JJ8 4.36e-112 331 51 2 313 3 cmoB tRNA U34 carboxymethyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3K7D4 1.78e-111 329 52 7 325 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q603L5 3.52e-111 328 52 4 326 3 cmoB tRNA U34 carboxymethyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0VQX6 4.41e-110 325 56 3 292 3 cmoB tRNA U34 carboxymethyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q4K6X6 3.03e-109 323 52 7 325 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1I5M7 3.93e-108 320 52 7 325 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas entomophila (strain L48)
C3K6Z3 4.52e-108 320 52 5 308 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas fluorescens (strain SBW25)
A5W8E5 5.16e-108 320 52 7 325 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1J4E4 5.63e-108 320 51 6 324 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain W619)
Q88MX8 6.48e-108 320 52 7 325 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4FQB2 6.99e-108 321 50 4 322 3 cmoB tRNA U34 carboxymethyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q2SJW1 1.68e-107 319 51 5 330 3 cmoB tRNA U34 carboxymethyltransferase Hahella chejuensis (strain KCTC 2396)
Q4ZPE5 1.85e-107 319 50 7 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas syringae pv. syringae (strain B728a)
B5EIQ6 1.91e-107 319 48 5 328 3 cmoB tRNA U34 carboxymethyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B0KV20 4.14e-107 318 51 7 325 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas putida (strain GB-1)
Q48EV7 5.55e-107 318 50 7 326 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C6E229 7.23e-107 317 48 3 318 3 cmoB tRNA U34 carboxymethyltransferase Geobacter sp. (strain M21)
Q87XG5 1.01e-106 317 50 7 326 1 cmoB tRNA U34 carboxymethyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q39SM2 4.61e-106 315 50 2 306 3 cmoB tRNA U34 carboxymethyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5WC55 5.33e-106 316 47 4 327 3 cmoB tRNA U34 carboxymethyltransferase Psychrobacter sp. (strain PRwf-1)
A4XSD0 8.03e-106 315 54 5 309 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas mendocina (strain ymp)
B3E6X8 2.03e-105 314 47 4 325 3 cmoB tRNA U34 carboxymethyltransferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B3PFU1 2.14e-105 313 49 1 307 3 cmoB tRNA U34 carboxymethyltransferase Cellvibrio japonicus (strain Ueda107)
A4VIY1 3.49e-105 313 54 4 289 3 cmoB tRNA U34 carboxymethyltransferase Stutzerimonas stutzeri (strain A1501)
C1DQS9 1.1e-104 311 51 7 326 3 cmoB tRNA U34 carboxymethyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1Q8I5 2.7e-104 312 47 4 335 3 cmoB tRNA U34 carboxymethyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q02HS6 1.65e-103 309 52 6 312 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYW8 1.65e-103 309 52 6 312 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain LESB58)
Q9I5G4 1.91e-103 308 52 6 312 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VAK2 1.93e-103 308 51 6 311 3 cmoB tRNA U34 carboxymethyltransferase Pseudomonas aeruginosa (strain PA7)
Q3A8E9 9.61e-86 264 46 3 279 3 cmoB tRNA U34 carboxymethyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C0QJG7 1.18e-84 261 45 4 285 3 cmoB tRNA U34 carboxymethyltransferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A1AVT4 3.34e-81 252 41 3 294 3 cmoB tRNA U34 carboxymethyltransferase Ruthia magnifica subsp. Calyptogena magnifica
A5EVQ5 3.33e-72 229 42 7 288 3 cmoB tRNA U34 carboxymethyltransferase Dichelobacter nodosus (strain VCS1703A)
Q6AIL0 7.05e-71 225 42 5 263 3 cmoB tRNA U34 carboxymethyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8EUD5 1.56e-69 221 41 3 253 3 cmoB tRNA U34 carboxymethyltransferase Aliarcobacter butzleri (strain RM4018)
Q30SA5 1.66e-67 216 38 6 280 3 cmoB tRNA U34 carboxymethyltransferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q10V92 2.82e-67 216 36 4 297 3 cmoB tRNA U34 carboxymethyltransferase Trichodesmium erythraeum (strain IMS101)
B9L8G5 3.57e-66 213 43 5 243 3 cmoB tRNA U34 carboxymethyltransferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q7VGI1 1.87e-64 209 37 5 288 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A7I1I7 2.42e-64 207 37 4 274 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A7ZEA2 1.38e-63 206 37 5 274 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter concisus (strain 13826)
A6Q7V3 1.69e-63 206 35 6 307 3 cmoB tRNA U34 carboxymethyltransferase Sulfurovum sp. (strain NBC37-1)
A6Q3V1 5.21e-63 204 37 3 273 3 cmoB tRNA U34 carboxymethyltransferase Nitratiruptor sp. (strain SB155-2)
Q7MS89 1.18e-62 203 38 3 278 3 cmoB tRNA U34 carboxymethyltransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B2UUE3 1.53e-62 202 42 2 240 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain Shi470)
O25173 2.69e-62 201 42 2 240 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
A0RPV3 2.01e-61 200 39 3 241 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter fetus subsp. fetus (strain 82-40)
B6JMM9 2.77e-61 199 41 2 240 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain P12)
B5Z809 1.24e-60 197 41 2 240 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain G27)
Q9ZKH1 1.84e-59 194 40 2 240 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
Q1CSN0 2.22e-59 194 41 2 240 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain HPAG1)
Q17Y58 2.74e-59 194 41 2 233 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter acinonychis (strain Sheeba)
A7GXW7 9.75e-59 194 35 3 253 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter curvus (strain 525.92)
A1VZW5 7.07e-57 189 36 2 238 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q0P9S6 7.63e-57 188 36 2 238 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5HUI4 1.6e-56 187 36 2 238 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni (strain RM1221)
A7H361 6.27e-56 186 36 2 238 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FM27 1.7e-55 185 36 2 236 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B9KFR5 5.13e-53 179 35 2 241 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q1GCH8 5.08e-07 53 36 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria sp. (strain TM1040)
A8LQ43 2.26e-06 51 32 4 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q5LWM6 5.38e-06 50 35 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q28VP7 5.61e-06 50 33 5 130 3 ubiG Ubiquinone biosynthesis O-methyltransferase Jannaschia sp. (strain CCS1)
A0A0A2IBN3 1.2e-05 49 30 7 165 1 cnsE O-methyltransferase cnsE Penicillium expansum
O74421 2.23e-05 48 29 7 172 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P44074 5.78e-05 47 29 4 138 4 HI_0912 Uncharacterized protein HI_0912 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q16D32 9.22e-05 47 32 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B9KPP7 0.000135 46 31 4 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4WW91 0.000162 46 32 4 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3IYM5 0.000198 45 31 4 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNM3 0.000223 45 31 4 121 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B3H0C8 0.000251 45 30 3 139 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZ07 0.000296 45 30 3 139 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3BSF8 0.000484 44 28 6 157 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q75G68 0.000534 45 28 2 123 2 PRMT6.2 Probable protein arginine N-methyltransferase 6.2 Oryza sativa subsp. japonica
A2Z8S0 0.000534 45 28 2 123 3 PRMT6.2 Probable protein arginine N-methyltransferase 6.2 Oryza sativa subsp. indica
Q1QEI9 0.000545 44 33 6 130 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A4YKT6 0.00059 44 27 3 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium sp. (strain ORS 278)
Q08A71 0.000639 45 25 6 178 2 PRMT6 Probable protein arginine N-methyltransferase 6 Arabidopsis thaliana
Q8PK00 0.000649 44 27 7 169 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q4FVG3 0.000791 43 33 6 130 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01110
Feature type CDS
Gene cmoB
Product tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB
Location 200092 - 201066 (strand: -1)
Length 975 (nucleotides) / 324 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_628
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08003 Protein of unknown function (DUF1698)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2227 Coenzyme transport and metabolism (H) H 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15257 tRNA (mo5U34)-methyltransferase [EC:2.1.1.-] - -

Protein Sequence

MIDFGNFYQLIAKNERLSHWLETLPAQIAKWNKESLHGYYPGWVKTIENLPDMTPDILDLKTGVTAQRTQPLTDGETRRINNILRNLMPWRKGPFSLYGVEIDTEWRSDLKWDRVLPHLSPLAGRTILDVGCGSGYHMWRMAGEGAELVVGVDPTQLFLCQFEAVRKLLGNDQRVHLLPLGIQELPALQAFDSVFSMGVLYHRRSPLDHLWQLKDQLVSGGELVLESIVVEGNEHQCLIPGERYAQMSNVYFIPSAKMLAVWLEKCGFINIRIVDESVTTTDEQRRTEWMINESLADFLNPDDPSLTVEGYPAPRRAVLIAEKP

Flanking regions ( +/- flanking 50bp)

GTTCCAGTGCTTTAACTTCGGGTCATTACTGGCAGTGAAAGAGAATAACCATGATTGATTTCGGCAATTTTTATCAGTTAATTGCAAAAAATGAGCGCCTGAGCCACTGGCTGGAAACACTGCCCGCGCAGATTGCGAAATGGAATAAAGAGTCCCTGCACGGCTACTATCCTGGCTGGGTAAAAACCATTGAAAATCTGCCGGACATGACTCCGGACATTCTCGATCTGAAAACCGGGGTTACTGCACAGCGCACACAGCCGTTGACCGACGGGGAAACCCGCCGTATCAATAACATTCTGCGCAACCTGATGCCGTGGCGTAAAGGCCCGTTCTCGCTCTACGGTGTGGAGATTGATACCGAATGGCGTTCTGATCTGAAATGGGATCGCGTTCTGCCGCATCTGTCCCCGCTTGCCGGGCGCACCATTCTGGATGTCGGCTGCGGCAGCGGTTATCACATGTGGCGCATGGCAGGTGAAGGCGCGGAACTGGTGGTCGGTGTTGATCCGACTCAGCTTTTCCTCTGCCAGTTTGAAGCCGTGCGCAAGCTGCTCGGCAATGACCAGCGCGTGCACCTGCTGCCGCTGGGTATTCAGGAACTGCCCGCACTTCAGGCTTTTGATTCCGTGTTCTCCATGGGTGTGCTTTATCACCGCCGCTCCCCGCTCGACCACCTCTGGCAACTGAAAGATCAGCTGGTGTCCGGCGGCGAACTGGTACTGGAAAGTATTGTTGTTGAGGGTAATGAACATCAGTGCCTGATCCCCGGCGAACGCTACGCGCAGATGAGCAACGTCTACTTTATTCCGTCAGCCAAAATGCTGGCTGTCTGGCTGGAAAAATGCGGCTTCATCAATATCAGGATCGTGGATGAGTCTGTCACCACCACGGATGAGCAGCGCCGTACGGAGTGGATGATCAATGAATCCCTCGCCGATTTCCTCAATCCTGACGACCCGTCACTGACGGTTGAAGGTTATCCCGCGCCGCGCCGCGCGGTGCTGATCGCCGAAAAGCCATAACCATCAGGAATGCGTATATACCCTGTCATTTGCAGGGTATATACCTCCGA