Homologs in group_679

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01900 FBDBKF_01900 59.1 Morganella morganii S1 - DUF2583 domain-containing protein
EHELCC_02370 EHELCC_02370 59.1 Morganella morganii S2 - DUF2583 domain-containing protein
NLDBIP_01090 NLDBIP_01090 59.1 Morganella morganii S4 - DUF2583 domain-containing protein
LHKJJB_00945 LHKJJB_00945 59.1 Morganella morganii S3 - DUF2583 domain-containing protein
HKOGLL_00985 HKOGLL_00985 59.1 Morganella morganii S5 - DUF2583 domain-containing protein
F4V73_RS04245 F4V73_RS04245 61.4 Morganella psychrotolerans - stress-induced protein YchH

Distribution of the homologs in the orthogroup group_679

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_679

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB49 2.31e-20 80 45 0 91 4 ychH Uncharacterized protein YchH Escherichia coli (strain K12)
P0AB50 2.31e-20 80 45 0 91 4 ychH Uncharacterized protein YchH Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AB51 2.31e-20 80 45 0 91 4 ychH Uncharacterized protein YchH Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05240
Feature type CDS
Gene ychH
Product stress-induced protein YchH
Location 1145953 - 1146231 (strand: 1)
Length 279 (nucleotides) / 92 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_679
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10762 Protein of unknown function (DUF2583)

Protein Sequence

MKYKHAFAVGNLLMAIGMVLMLGSLGYNLLSHIFPLGLPDILSDASLMGIFIGALVWLAGARIGGRETVAERYWWLRNHDERYRRHDNHRYP

Flanking regions ( +/- flanking 50bp)

TTGATGTATTTTGGTGTTGAATCGTCTGACGACGCGCTTGGAGGTGCAACATGAAATATAAACATGCTTTTGCCGTTGGCAATTTATTGATGGCTATCGGTATGGTGCTTATGCTCGGTAGTCTTGGTTATAATCTTCTTAGCCATATTTTTCCATTAGGACTACCTGATATTTTATCTGATGCTTCGCTAATGGGGATCTTTATTGGTGCACTTGTTTGGTTAGCAGGGGCTCGTATTGGTGGTAGAGAAACCGTTGCAGAAAGATATTGGTGGTTGCGTAATCATGACGAACGTTATCGTCGCCATGATAATCATCGTTATCCATAACAGTGTGGGCATCAATAAAATATAGATAAAATCATAATTCATAATAGAGT