Homologs in group_606

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01900 FBDBKF_01900 100.0 Morganella morganii S1 - DUF2583 domain-containing protein
EHELCC_02370 EHELCC_02370 100.0 Morganella morganii S2 - DUF2583 domain-containing protein
NLDBIP_01090 NLDBIP_01090 100.0 Morganella morganii S4 - DUF2583 domain-containing protein
HKOGLL_00985 HKOGLL_00985 100.0 Morganella morganii S5 - DUF2583 domain-containing protein
F4V73_RS04245 F4V73_RS04245 87.6 Morganella psychrotolerans - stress-induced protein YchH
PMI_RS05240 PMI_RS05240 59.1 Proteus mirabilis HI4320 ychH stress-induced protein YchH

Distribution of the homologs in the orthogroup group_606

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_606

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB49 1.44e-12 60 37 1 86 4 ychH Uncharacterized protein YchH Escherichia coli (strain K12)
P0AB50 1.44e-12 60 37 1 86 4 ychH Uncharacterized protein YchH Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AB51 1.44e-12 60 37 1 86 4 ychH Uncharacterized protein YchH Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_00945
Feature type CDS
Gene -
Product DUF2583 domain-containing protein
Location 168366 - 168635 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_606
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10762 Protein of unknown function (DUF2583)

Protein Sequence

MKRKLSLLLGNLLMVVGMLLMVGSMAFTVGVLIFALPLPDIYSEASLMGIFIGALVWLGGAGLSGRRESIADKYYWLRHFHSRYRRRMP

Flanking regions ( +/- flanking 50bp)

TACTTTCGTACTTTGAGTTGTTAGCAGACAAAAGAGTGGCGGAGGTCCCTATGAAACGTAAATTATCCTTATTGCTCGGTAACCTGCTGATGGTTGTCGGTATGCTGTTGATGGTCGGCAGTATGGCCTTTACTGTCGGTGTCCTTATTTTTGCACTTCCTTTACCGGATATCTATTCTGAAGCCTCCCTGATGGGGATCTTTATCGGTGCCCTGGTGTGGCTGGGCGGAGCCGGTCTGAGCGGGCGCCGTGAATCCATTGCGGATAAATATTACTGGCTGCGTCATTTCCACAGCCGCTACCGCCGCCGGATGCCGTAAACGAAATATTATCGCTAACGGTTAAAATGCCTGCCAACAAAAAACCCGTT