Homologs in group_367

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13390 FBDBKF_13390 55.8 Morganella morganii S1 btuC vitamin B12 ABC transporter permease BtuC
EHELCC_08705 EHELCC_08705 55.8 Morganella morganii S2 btuC vitamin B12 ABC transporter permease BtuC
NLDBIP_09030 NLDBIP_09030 55.8 Morganella morganii S4 btuC vitamin B12 ABC transporter permease BtuC
LHKJJB_05235 LHKJJB_05235 55.8 Morganella morganii S3 btuC vitamin B12 ABC transporter permease BtuC
HKOGLL_05680 HKOGLL_05680 55.8 Morganella morganii S5 btuC vitamin B12 ABC transporter permease BtuC
F4V73_RS03370 F4V73_RS03370 56.1 Morganella psychrotolerans btuC vitamin B12 ABC transporter permease BtuC
PMI_RS14625 PMI_RS14625 29.8 Proteus mirabilis HI4320 - iron chelate uptake ABC transporter family permease subunit

Distribution of the homologs in the orthogroup group_367

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_367

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GDR2 2.93e-123 360 58 1 324 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
B1JJ25 3.6e-123 360 57 1 307 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 3.6e-123 360 57 1 307 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 3.6e-123 360 57 1 307 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 3.6e-123 360 57 1 307 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 3.6e-123 360 57 1 307 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 3.6e-123 360 57 1 307 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JPQ9 3.09e-122 358 60 1 291 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N3Q3 6.35e-121 354 59 1 327 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D656 1e-110 328 54 2 326 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TAH6 1.55e-105 315 53 2 319 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3Z259 5.95e-103 308 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
A9MFB6 2.37e-102 307 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BA35 3.43e-102 306 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 3.43e-102 306 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z6I5 8.95e-102 305 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
B4T4N5 1.86e-101 305 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 1.86e-101 305 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 1.86e-101 305 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
Q8ZPS8 2.05e-101 304 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 2.05e-101 304 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 2.05e-101 304 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 2.05e-101 304 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 2.05e-101 304 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 2.05e-101 304 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
Q32FI8 2.31e-101 304 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
A8AHA4 4.53e-101 303 53 2 296 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q57PU6 9.29e-101 303 53 2 291 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
Q0T4S1 3.93e-98 296 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
Q0THB7 4.43e-98 296 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7US50 5.33e-98 296 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q7C1M5 6.7e-98 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
B6I8R6 8.89e-98 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
B1IPL6 9.91e-98 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 9.91e-98 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
Q1RB84 1.02e-97 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 1.02e-97 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 1.02e-97 295 55 2 291 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 1.02e-97 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 1.02e-97 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 1.02e-97 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 1.02e-97 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 1.02e-97 295 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
B7MVJ0 1.6e-97 295 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
B7N549 1.8e-97 294 55 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FH26 2.03e-97 294 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7L6I4 3.35e-97 294 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
B7M1C0 4.07e-97 293 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 4.07e-97 293 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
B5YPZ9 6.79e-97 293 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 6.79e-97 293 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
B2U360 6.52e-96 290 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q321G8 2.23e-94 286 54 2 291 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
B7LQ78 2.65e-94 286 51 2 317 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q6LQ76 1.68e-76 241 44 3 330 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
Q9KSL2 1.73e-75 238 48 5 325 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MLE7 1.3e-69 223 48 2 272 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q8D927 1.91e-69 223 47 2 272 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
Q87Q39 1.59e-66 215 43 3 330 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q56992 3.54e-58 194 42 4 290 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
Q57552 3.7e-45 160 33 6 342 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P49937 1.19e-41 151 34 6 320 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
Q57130 4.2e-40 147 38 5 269 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O34832 2.48e-39 145 34 6 333 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
O34451 1.31e-38 143 37 7 287 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
Q9HQ19 7.89e-38 142 36 5 290 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 7.89e-38 142 36 5 290 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O31569 1.23e-37 140 33 5 337 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
P40411 4.56e-36 136 30 8 330 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
O34933 1.15e-35 135 35 4 280 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
Q81L64 8.68e-35 137 32 4 337 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 2.88e-18 89 31 7 290 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
P15029 2.78e-33 128 33 5 317 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
P49936 9.49e-32 125 31 8 358 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
P37738 5.06e-30 119 32 4 308 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
O31568 6.24e-29 117 34 7 283 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
Q47085 2.36e-28 115 35 10 323 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
O05731 1.19e-27 113 32 6 290 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZKW2 1.95e-26 110 31 6 290 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
O87656 2.37e-26 113 33 6 295 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 2.76e-10 65 30 8 270 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P06972 3.53e-26 112 32 8 314 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 9.52e-08 57 28 6 269 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
Q2YX91 2.59e-25 107 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NX64 4.01e-25 106 32 6 311 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 4.01e-25 106 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
Q6GHV2 7.57e-25 105 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 7.57e-25 105 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 7.57e-25 105 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 7.57e-25 105 32 6 311 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 7.57e-25 105 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 7.57e-25 105 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 7.57e-25 105 32 6 311 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
P40410 7.49e-24 103 32 7 286 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
P15030 1.67e-23 102 29 7 314 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
Q47086 4.96e-23 101 31 7 294 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
P23876 1.94e-22 99 36 12 289 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
Q2FZE5 3.83e-22 98 32 7 311 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q81XB1 1.35e-21 97 30 8 281 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
P94418 5.19e-20 92 25 6 317 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
P23877 1.51e-16 82 31 6 290 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)
Q58286 8.04e-10 63 22 8 303 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P94419 1.33e-07 56 25 5 225 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
Q58287 0.000322 43 33 1 81 3 MJ0877 Putative ABC transporter permease protein MJ0877 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05060
Feature type CDS
Gene btuC
Product vitamin B12 ABC transporter permease BtuC
Location 1105734 - 1106768 (strand: 1)
Length 1035 (nucleotides) / 344 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_367
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4139 Coenzyme transport and metabolism (H) H ABC-type cobalamin transport system, permease component BtuC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06073 vitamin B12 transport system permease protein ABC transporters -

Protein Sequence

MGYLLNNMNNQYDDPLNQLRHKQQISDKLKLTLLVLVLFVLIVISLSAGEIWLFPNKWLTEEASLFIWQIRLPRILAVMMVGASLAIAGAIMQAIFENPLAEPGLLGVSSGAGVCVVLLIVFQLGTAYWLISSAAILGALGITCLLMFFSQIKKLSNAQLLLIGVALGVLASAVMTWLVYFSSALDLRQLMYWLMGSFSGIDWRHQILFWALLPIITLLIWQADILNYLSLGSFEAKKLGISVIIWRNWFILTVGLLIGFSVALAGAISFVGLIVPHLLRLSGITHYKTLLPGCALTGASLLIFADLISRLMLNGAEVPIGVITATLGAPLFIWLLATKQMERL

Flanking regions ( +/- flanking 50bp)

TATGTTGCCCTACATTTATTAGCAATATATTTATAAAAATAGCGTAATTTATGGGCTATTTACTAAACAATATGAATAATCAATATGATGATCCGCTTAATCAATTACGACACAAACAGCAAATTAGTGATAAGCTAAAACTCACTTTGCTGGTGTTAGTTTTATTTGTTCTTATTGTTATCTCACTTTCAGCCGGTGAAATTTGGTTATTCCCCAATAAATGGCTCACTGAAGAAGCTAGTTTATTTATTTGGCAAATTAGGCTTCCAAGAATATTGGCTGTGATGATGGTTGGCGCAAGCTTAGCGATTGCTGGTGCCATTATGCAGGCAATCTTTGAAAATCCGTTAGCAGAGCCGGGACTTTTAGGTGTAAGCAGTGGTGCGGGTGTTTGTGTTGTGTTACTGATTGTTTTCCAATTAGGAACTGCATACTGGTTAATAAGCAGTGCCGCGATATTAGGGGCTTTGGGGATCACCTGCTTATTAATGTTTTTCTCACAAATAAAAAAACTATCTAATGCTCAATTATTATTAATAGGCGTAGCATTAGGGGTATTAGCAAGTGCTGTTATGACTTGGCTGGTCTATTTTAGCTCTGCGTTAGATTTAAGACAATTAATGTACTGGCTTATGGGGAGCTTTAGTGGCATTGACTGGCGTCACCAAATATTATTTTGGGCATTACTTCCAATCATCACACTTCTTATTTGGCAAGCCGATATTTTAAATTACCTTTCTCTGGGGAGTTTTGAAGCCAAAAAACTCGGCATTTCTGTGATTATATGGCGTAATTGGTTTATTTTAACCGTTGGTTTATTAATTGGTTTTAGCGTTGCTCTAGCCGGCGCAATTAGTTTTGTCGGGTTGATTGTACCGCATTTATTACGATTGTCTGGTATCACACATTATAAAACCTTGTTACCGGGCTGTGCTTTAACGGGAGCGAGTTTACTGATATTCGCTGATTTAATATCAAGGCTGATGTTAAATGGCGCAGAAGTCCCTATTGGCGTGATAACTGCCACCTTAGGCGCACCTCTTTTTATTTGGTTATTAGCCACTAAACAGATGGAGCGCTTATAATATGGCACAATTAAAACTATATAAATTAGCTGTCAATAAAAGACTATATG