Homologs in group_367

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_08705 EHELCC_08705 100.0 Morganella morganii S2 btuC vitamin B12 ABC transporter permease BtuC
NLDBIP_09030 NLDBIP_09030 100.0 Morganella morganii S4 btuC vitamin B12 ABC transporter permease BtuC
LHKJJB_05235 LHKJJB_05235 100.0 Morganella morganii S3 btuC vitamin B12 ABC transporter permease BtuC
HKOGLL_05680 HKOGLL_05680 100.0 Morganella morganii S5 btuC vitamin B12 ABC transporter permease BtuC
F4V73_RS03370 F4V73_RS03370 91.1 Morganella psychrotolerans btuC vitamin B12 ABC transporter permease BtuC
PMI_RS05060 PMI_RS05060 55.8 Proteus mirabilis HI4320 btuC vitamin B12 ABC transporter permease BtuC
PMI_RS14625 PMI_RS14625 28.7 Proteus mirabilis HI4320 - iron chelate uptake ABC transporter family permease subunit

Distribution of the homologs in the orthogroup group_367

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_367

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3Q3 7.12e-130 377 64 0 330 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JJ25 9.67e-130 376 62 0 309 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 9.67e-130 376 62 0 309 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 9.67e-130 376 62 0 309 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 9.67e-130 376 62 0 309 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 9.67e-130 376 62 0 309 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 9.67e-130 376 62 0 309 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JPQ9 3.44e-126 367 63 0 293 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GDR2 6.57e-122 357 56 0 330 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
A6TAH6 5.24e-118 347 57 1 329 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6D656 9.35e-118 346 58 1 325 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Z6I5 2.4e-115 340 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
B4T4N5 3.15e-115 339 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 3.15e-115 339 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 3.15e-115 339 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
Q8ZPS8 5.74e-115 338 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 5.74e-115 338 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 5.74e-115 338 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 5.74e-115 338 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 5.74e-115 338 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 5.74e-115 338 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
Q57PU6 1.03e-114 338 59 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
A8AHA4 2.95e-114 337 56 2 330 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MFB6 3.36e-114 337 57 1 327 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BA35 8.48e-114 335 58 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 8.48e-114 335 58 1 320 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3Z259 1.33e-113 335 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
Q32FI8 8.73e-112 330 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
Q0THB7 7.21e-110 325 59 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FH26 7.87e-110 325 59 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7US50 8.77e-110 325 59 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7LQ78 1.01e-109 325 57 1 321 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7MVJ0 1.37e-109 325 59 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
B7L6I4 7.51e-109 323 58 1 324 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
Q0T4S1 1.35e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
B7M1C0 1.56e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 1.56e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7C1M5 1.78e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
B1IPL6 1.83e-108 322 58 1 324 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 1.83e-108 322 58 1 324 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
B5YPZ9 2.07e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 2.07e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
Q1RB84 2.09e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 2.09e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 2.09e-108 322 58 1 322 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 2.09e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 2.09e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 2.09e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 2.09e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 2.09e-108 322 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
B6I8R6 3.77e-108 321 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
B7N549 5.89e-108 321 58 1 322 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2U360 1.19e-106 317 57 1 324 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q321G8 2.25e-105 314 57 1 324 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
Q6LQ76 9.86e-77 241 45 4 330 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
Q9KSL2 3.37e-76 240 47 2 325 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87Q39 5.43e-75 237 43 0 327 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D927 6.82e-74 234 47 0 273 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
Q7MLE7 7.43e-74 234 48 0 273 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q56992 5.64e-56 188 39 4 292 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
Q57552 8.97e-51 175 34 5 336 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O34832 2.79e-49 171 37 6 335 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
O34451 4.22e-45 160 40 6 285 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
P49937 4.5e-44 157 32 7 338 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
P40411 2.8e-43 155 30 6 343 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
Q57130 3.93e-40 147 34 9 334 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O31569 1.28e-39 145 32 2 288 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
Q9HQ19 7.66e-38 141 36 6 291 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 7.66e-38 141 36 6 291 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O34933 2.44e-37 139 34 3 283 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
Q47085 2.64e-37 139 38 7 323 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
O31568 4.79e-36 135 34 9 335 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
Q81L64 3.84e-35 138 32 8 336 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 1.37e-24 107 32 6 299 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
P15029 7.54e-35 132 38 6 278 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
P49936 1.24e-33 130 34 6 292 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
P15030 2.76e-29 117 33 5 284 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
P40410 3.38e-26 109 28 7 296 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
P06972 1.48e-25 110 31 12 348 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 9.08e-12 69 30 7 268 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
O05731 3.55e-25 106 33 9 296 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
O87656 5.51e-25 109 32 7 292 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 9.8e-13 72 29 6 268 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47086 5.96e-25 106 32 1 282 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
Q9ZKW2 4.75e-24 103 31 9 305 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
P23876 1.18e-23 102 34 6 283 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
Q2YX91 1.63e-23 102 30 6 291 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q81XB1 7.28e-23 100 29 4 266 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
Q6GHV2 6.86e-22 97 30 6 291 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 6.86e-22 97 30 6 291 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 6.86e-22 97 30 6 291 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 6.86e-22 97 30 6 291 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 6.86e-22 97 30 6 291 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 6.86e-22 97 30 6 291 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 6.86e-22 97 30 6 291 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NX64 1.03e-21 97 30 6 284 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 1.03e-21 97 30 6 284 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
P37738 5.63e-20 92 27 10 322 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
P94418 2.52e-19 90 26 9 325 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
Q2FZE5 4.31e-19 89 31 7 291 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
P23877 1.6e-17 85 27 10 325 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)
Q58286 2.34e-15 79 24 6 251 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P94419 1.82e-08 58 20 6 286 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
Q81XB2 4.56e-05 48 23 7 293 1 fatC Petrobactin import system permease protein FatC Bacillus anthracis
Q58287 0.000133 44 35 2 94 3 MJ0877 Putative ABC transporter permease protein MJ0877 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13390
Feature type CDS
Gene btuC
Product vitamin B12 ABC transporter permease BtuC
Location 56074 - 57084 (strand: -1)
Length 1011 (nucleotides) / 336 (amino acids)

Contig

Accession contig_16
Length 109220 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_367
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4139 Coenzyme transport and metabolism (H) H ABC-type cobalamin transport system, permease component BtuC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06073 vitamin B12 transport system permease protein ABC transporters -

Protein Sequence

MHIHNPITKLVQTRKKRDVQRIILLSVTLLIMIAVALCAGEMWILPDQWLSETAQLFVWDLRFPRVLAVIAVGAGLAMAGAVMQAIFENPLAEPGLLGVSNGAGVFVVFIVLFFKGMPPLWVLGGGAVIGATLLTLILLWFAHFRRLSNSQLLLVGVALGVICGAFMTWMVYFSTSLDLRQLMYWMMGSFSGADWRLSPLLAAIAVVAVWLLWQAPVLNYLALGEVNAQQLGVSAHRWRNVFIIAVGLLIGLSVAVAGAISFIGLIIPHMLRLMGITDHRTLLPACALFGAVSLLLADLCSRLILSNAEIPIGVVTATIGAPAFIYLLTRHHGGRR

Flanking regions ( +/- flanking 50bp)

ACTCTGACTCAGGTATACTGCCTCCCGTCTTGAACAATGACAGGGATCTCATGCATATTCACAACCCCATCACGAAGCTGGTACAGACGCGGAAAAAGCGGGATGTACAGCGCATAATTCTTCTTTCTGTTACCTTGCTGATAATGATCGCCGTTGCACTGTGCGCCGGTGAGATGTGGATTTTACCGGACCAGTGGTTATCTGAAACCGCACAGTTATTTGTCTGGGATCTGCGTTTCCCGCGTGTGCTGGCGGTGATTGCGGTGGGGGCCGGGCTGGCAATGGCCGGTGCGGTGATGCAGGCCATTTTTGAAAACCCGCTGGCGGAACCGGGGCTGCTCGGCGTGAGTAACGGTGCCGGGGTGTTTGTTGTCTTTATCGTCCTGTTTTTCAAAGGCATGCCGCCGCTGTGGGTGCTGGGGGGCGGGGCGGTGATCGGGGCGACACTGCTGACACTGATTTTACTCTGGTTTGCCCATTTCCGGCGGCTGAGTAACAGCCAGCTGCTGCTGGTCGGGGTGGCTCTCGGGGTTATCTGCGGCGCATTTATGACCTGGATGGTGTATTTCAGCACCAGTCTGGATTTACGTCAGCTGATGTACTGGATGATGGGAAGTTTTTCCGGGGCGGACTGGCGGCTCAGTCCGCTGCTGGCAGCGATAGCGGTGGTGGCCGTGTGGCTGCTGTGGCAGGCACCGGTGCTTAACTATCTTGCACTGGGCGAGGTTAATGCCCAGCAGCTCGGGGTATCGGCACACCGCTGGCGCAATGTGTTTATTATTGCCGTCGGGTTGCTGATCGGCCTGAGTGTGGCGGTGGCCGGCGCTATCAGCTTTATCGGGCTGATTATCCCGCATATGCTGCGGCTGATGGGTATTACCGATCACCGGACATTATTACCCGCCTGTGCATTATTTGGTGCCGTCAGTCTGTTGCTGGCGGATTTATGCTCACGGCTGATTTTATCCAATGCCGAAATTCCGATCGGCGTGGTGACTGCAACCATCGGCGCACCGGCCTTTATTTATCTGCTGACCCGGCATCACGGAGGACGCCGCTGATGGATAATCTGTTACTTGATGTCAGCGGGATCCACATCGGCCGCCGTCTT