Homologs in group_575

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00930 FBDBKF_00930 64.6 Morganella morganii S1 csaA tRNA-binding protein
EHELCC_00615 EHELCC_00615 64.6 Morganella morganii S2 csaA tRNA-binding protein
NLDBIP_02845 NLDBIP_02845 64.6 Morganella morganii S4 csaA tRNA-binding protein
LHKJJB_04360 LHKJJB_04360 64.6 Morganella morganii S3 csaA tRNA-binding protein
HKOGLL_02685 HKOGLL_02685 64.6 Morganella morganii S5 csaA tRNA-binding protein
F4V73_RS06925 F4V73_RS06925 63.7 Morganella psychrotolerans - tRNA-binding protein

Distribution of the homologs in the orthogroup group_575

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_575

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37584 1.75e-26 97 46 1 106 1 csaA Probable chaperone CsaA Bacillus subtilis (strain 168)
A6UUN1 1.18e-13 68 36 2 98 3 metG Methionine--tRNA ligase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q46F18 2.4e-13 68 38 2 95 3 metG Methionine--tRNA ligase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q81W03 3.91e-13 67 36 4 109 3 metG1 Methionine--tRNA ligase 1 Bacillus anthracis
Q81JA8 7.64e-13 66 36 4 109 3 metG1 Methionine--tRNA ligase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8PYJ4 4.09e-12 64 36 2 95 3 metG Methionine--tRNA ligase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
B2RHF5 1.15e-11 63 34 2 93 3 metG Methionine--tRNA ligase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8TIU5 3.4e-11 62 36 2 95 3 metG Methionine--tRNA ligase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q7MXK7 8.42e-11 60 33 2 93 3 metG Methionine--tRNA ligase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A4SE77 1.53e-10 60 32 3 107 3 metG Methionine--tRNA ligase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q5L7I8 2.55e-10 59 31 2 95 3 metG Methionine--tRNA ligase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64MP7 2.7e-10 59 31 2 95 3 metG Methionine--tRNA ligase Bacteroides fragilis (strain YCH46)
Q0W0H2 2.7e-10 59 38 2 91 3 metG Methionine--tRNA ligase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Q3AQR4 2.71e-10 59 34 2 96 3 metG Methionine--tRNA ligase Chlorobium chlorochromatii (strain CaD3)
P42589 2.86e-10 56 30 3 110 1 ygjH tRNA-binding protein YgjH Escherichia coli (strain K12)
Q9RUF3 3.65e-10 58 31 2 111 3 metG Methionine--tRNA ligase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q8A3M1 5.43e-10 58 32 2 95 3 metG Methionine--tRNA ligase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P37465 7.68e-10 58 32 4 108 3 metG Methionine--tRNA ligase Bacillus subtilis (strain 168)
A0B7K2 1.19e-09 57 37 3 104 3 metG Methionine--tRNA ligase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q58659 2.02e-09 57 30 2 100 3 metG Methionine--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q3B3N3 2.18e-09 57 34 4 108 3 metG Methionine--tRNA ligase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A5FLM7 2.86e-09 56 29 2 107 3 metG Methionine--tRNA ligase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q2FU77 4.49e-09 55 33 4 110 3 metG Methionine--tRNA ligase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q92F90 4.62e-09 55 30 2 110 3 metG Methionine--tRNA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P23395 7.53e-09 55 35 3 102 1 metG Methionine--tRNA ligase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9V011 1.29e-08 54 33 3 107 1 metG Methionine--tRNA ligase Pyrococcus abyssi (strain GE5 / Orsay)
B3ECI3 1.33e-08 54 35 4 105 3 metG Methionine--tRNA ligase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A6LFP0 1.41e-08 54 31 2 95 3 metG Methionine--tRNA ligase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q9KGK8 1.52e-08 54 31 4 110 3 metG Methionine--tRNA ligase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3SKG8 1.61e-08 54 33 1 93 3 metG Methionine--tRNA ligase Thiobacillus denitrificans (strain ATCC 25259)
Q8YAF2 1.94e-08 54 30 2 110 3 metG Methionine--tRNA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q724N6 2e-08 53 30 2 110 3 metG Methionine--tRNA ligase Listeria monocytogenes serotype 4b (strain F2365)
A6GVQ2 2.66e-08 53 35 3 95 3 metG Methionine--tRNA ligase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q8CQU3 2.73e-08 53 31 4 115 3 metG Methionine--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRR5 2.73e-08 53 31 4 115 3 metG Methionine--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8NY00 2.86e-08 53 32 3 106 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain MW2)
Q6GBZ8 2.86e-08 53 32 3 106 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain MSSA476)
Q12UQ9 3.26e-08 53 35 2 97 3 metG Methionine--tRNA ligase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q5JDZ7 3.58e-08 53 30 3 107 3 metG Methionine--tRNA ligase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q74MZ1 3.67e-08 53 32 3 107 1 metG Methionine--tRNA ligase Nanoarchaeum equitans (strain Kin4-M)
P23920 3.68e-08 53 33 2 107 3 metG Methionine--tRNA ligase Geobacillus stearothermophilus
P67579 3.68e-08 53 32 3 106 1 metG Methionine--tRNA ligase Staphylococcus aureus (strain N315)
P67578 3.68e-08 53 32 3 106 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HII6 3.75e-08 53 32 3 106 1 metG Methionine--tRNA ligase Staphylococcus aureus (strain COL)
Q6GJI1 3.83e-08 53 32 3 106 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain MRSA252)
O58721 4.34e-08 53 30 3 97 3 metG Methionine--tRNA ligase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q6MMA3 4.58e-08 53 30 2 108 3 metG Methionine--tRNA ligase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q8EZD6 4.82e-08 53 41 2 90 3 metG Methionine--tRNA ligase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72MR4 5.06e-08 53 41 2 90 3 metG Methionine--tRNA ligase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8TX28 5.6e-08 52 28 2 107 3 metG Methionine--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
A6URW2 6.92e-08 52 29 3 107 3 metG Methionine--tRNA ligase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q49UZ9 7.12e-08 52 32 3 106 3 metG Methionine--tRNA ligase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B0SQX5 9.84e-08 52 34 3 104 3 metG Methionine--tRNA ligase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SHA8 9.84e-08 52 34 3 104 3 metG Methionine--tRNA ligase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A9FBU8 9.86e-08 52 37 1 85 3 metG1 Methionine--tRNA ligase 1 Sorangium cellulosum (strain So ce56)
B6YUN0 1.25e-07 52 28 4 108 3 metG Methionine--tRNA ligase Thermococcus onnurineus (strain NA1)
Q4L3E7 1.31e-07 51 32 3 105 3 metG Methionine--tRNA ligase Staphylococcus haemolyticus (strain JCSC1435)
Q3BVP1 1.62e-07 51 29 2 105 3 metG Methionine--tRNA ligase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q9ZKG9 2.09e-07 51 31 1 100 3 metG Methionine--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
Q8PMP0 2.14e-07 51 30 2 97 1 metG Methionine--tRNA ligase Xanthomonas axonopodis pv. citri (strain 306)
A1BF81 2.68e-07 50 32 2 96 3 metG Methionine--tRNA ligase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q1D8K2 2.79e-07 50 32 1 86 3 metG Methionine--tRNA ligase Myxococcus xanthus (strain DK1622)
Q8RDD1 3.01e-07 50 28 3 108 3 metG Methionine--tRNA ligase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6LSZ7 3.18e-07 50 36 2 87 3 metG Methionine--tRNA ligase Photobacterium profundum (strain SS9)
A4FZL1 4.12e-07 50 28 3 104 3 metG Methionine--tRNA ligase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q8U221 4.32e-07 50 30 4 108 3 metG Methionine--tRNA ligase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6M0E5 4.54e-07 50 27 3 109 3 metG Methionine--tRNA ligase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A7I6H7 5.9e-07 50 30 4 113 3 metG Methionine--tRNA ligase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q480H5 6.42e-07 49 34 3 96 3 metG Methionine--tRNA ligase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0VP51 6.53e-07 49 34 1 90 3 metG Methionine--tRNA ligase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A6VIW5 7.38e-07 49 29 3 104 3 metG Methionine--tRNA ligase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q15UM1 7.91e-07 49 32 2 89 3 metG Methionine--tRNA ligase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
O33925 9.91e-07 49 29 2 95 3 metG Methionine--tRNA ligase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q054R6 1.01e-06 49 39 2 83 3 metG Methionine--tRNA ligase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04Q66 1.01e-06 49 39 2 83 3 metG Methionine--tRNA ligase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q1LJN4 1.34e-06 48 31 4 114 3 metG Methionine--tRNA ligase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B4SRG1 1.45e-06 48 30 2 98 3 metG Methionine--tRNA ligase Stenotrophomonas maltophilia (strain R551-3)
P56127 1.49e-06 48 30 1 97 3 metG Methionine--tRNA ligase Helicobacter pylori (strain ATCC 700392 / 26695)
B4SGQ6 1.58e-06 48 31 2 107 3 metG Methionine--tRNA ligase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q87B68 1.74e-06 48 29 2 102 3 metG Methionine--tRNA ligase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I7S0 1.74e-06 48 29 2 102 3 metG Methionine--tRNA ligase Xylella fastidiosa (strain M23)
Q8PAY7 1.84e-06 48 29 2 101 3 metG Methionine--tRNA ligase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4USM5 1.84e-06 48 29 2 101 3 metG Methionine--tRNA ligase Xanthomonas campestris pv. campestris (strain 8004)
B2FPT0 1.97e-06 48 29 2 94 3 metG Methionine--tRNA ligase Stenotrophomonas maltophilia (strain K279a)
B0RWA1 1.99e-06 48 29 2 103 3 metG Methionine--tRNA ligase Xanthomonas campestris pv. campestris (strain B100)
B3QT85 2.18e-06 48 29 2 93 3 metG Methionine--tRNA ligase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B3R678 2.69e-06 48 32 2 94 3 metG Methionine--tRNA ligase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K7K0 2.79e-06 48 32 4 115 3 metG Methionine--tRNA ligase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A0M5Z9 2.8e-06 48 28 3 104 3 metG Methionine--tRNA ligase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q5H1J3 3.2e-06 47 28 2 102 3 metG Methionine--tRNA ligase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SRQ4 3.2e-06 47 28 2 102 3 metG Methionine--tRNA ligase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P4E9 3.2e-06 47 28 2 102 3 metG Methionine--tRNA ligase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A6KYR3 3.45e-06 47 27 3 109 3 metG Methionine--tRNA ligase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A3CX39 3.62e-06 47 29 3 104 3 metG Methionine--tRNA ligase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q474X7 3.67e-06 47 31 4 115 3 metG Methionine--tRNA ligase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q12904 6.29e-06 47 31 4 104 1 AIMP1 Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 Homo sapiens
Q1H2F4 6.88e-06 47 30 1 97 3 metG1 Methionine--tRNA ligase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1WUY7 7.07e-06 47 33 3 95 3 metG Methionine--tRNA ligase Halorhodospira halophila (strain DSM 244 / SL1)
B0U472 9.58e-06 46 28 2 102 3 metG Methionine--tRNA ligase Xylella fastidiosa (strain M12)
Q9PFV8 9.58e-06 46 28 2 102 3 metG Methionine--tRNA ligase Xylella fastidiosa (strain 9a5c)
A5UJ98 1.03e-05 46 32 3 100 3 metG Methionine--tRNA ligase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q11RM3 1.05e-05 46 30 1 92 3 metG Methionine--tRNA ligase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
P59077 1.31e-05 46 27 3 98 3 metG Methionine--tRNA ligase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9KT69 1.61e-05 45 29 2 107 3 metG Methionine--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2P8 1.61e-05 45 29 2 107 3 metG Methionine--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q837B3 1.63e-05 45 28 3 117 3 metG Methionine--tRNA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
P31230 1.78e-05 45 30 3 99 1 Aimp1 Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 Mus musculus
Q5WST1 1.93e-05 45 31 2 102 3 metG Methionine--tRNA ligase Legionella pneumophila (strain Lens)
A5II55 1.93e-05 45 31 2 102 3 metG Methionine--tRNA ligase Legionella pneumophila (strain Corby)
A5WG58 1.96e-05 45 25 2 115 3 metG Methionine--tRNA ligase Psychrobacter sp. (strain PRwf-1)
O26687 2.19e-05 45 33 3 90 3 metG Methionine--tRNA ligase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q2SKU2 2.22e-05 45 30 3 89 3 metG Methionine--tRNA ligase Hahella chejuensis (strain KCTC 2396)
Q1QAD0 2.52e-05 45 28 3 114 3 metG Methionine--tRNA ligase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B6EIY5 2.67e-05 45 34 3 89 3 metG Methionine--tRNA ligase Aliivibrio salmonicida (strain LFI1238)
Q5ZRJ9 3.14e-05 45 31 2 102 3 metG Methionine--tRNA ligase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X105 3.14e-05 45 31 2 102 3 metG Methionine--tRNA ligase Legionella pneumophila (strain Paris)
A6VQD5 3.15e-05 45 30 3 108 3 metG Methionine--tRNA ligase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7ZX51 3.34e-05 44 33 4 95 2 yars1 Tyrosine--tRNA ligase, cytoplasmic Xenopus laevis
Q7MM14 3.37e-05 45 32 2 87 3 metG Methionine--tRNA ligase Vibrio vulnificus (strain YJ016)
Q8D8F2 3.37e-05 45 32 2 87 3 metG Methionine--tRNA ligase Vibrio vulnificus (strain CMCP6)
Q82WP0 3.87e-05 44 28 3 94 3 metG Methionine--tRNA ligase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7URP3 4.72e-05 44 31 1 95 3 metG Methionine--tRNA ligase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B8GFL4 5.14e-05 44 32 4 95 3 metG Methionine--tRNA ligase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q9SVN5 5.22e-05 44 33 3 87 2 At4g13780 Methionine--tRNA ligase, cytoplasmic Arabidopsis thaliana
Q8XWT9 5.31e-05 44 30 2 91 3 metG Methionine--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q21TB9 7.04e-05 43 31 4 102 3 metG Methionine--tRNA ligase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A5EY62 9.11e-05 43 27 1 88 3 metG Methionine--tRNA ligase Dichelobacter nodosus (strain VCS1703A)
Q0BCT3 9.72e-05 43 30 2 90 3 metG Methionine--tRNA ligase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YUT2 9.72e-05 43 30 2 90 3 metG Methionine--tRNA ligase Burkholderia ambifaria (strain MC40-6)
Q47IK0 9.78e-05 43 31 1 87 3 metG Methionine--tRNA ligase Dechloromonas aromatica (strain RCB)
Q54X95 0.000138 43 29 1 79 3 metS Probable methionine--tRNA ligase, cytoplasmic Dictyostelium discoideum
Q4FRS8 0.00015 43 27 1 95 3 metG Methionine--tRNA ligase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A9AHJ8 0.000153 43 28 2 91 3 metG Methionine--tRNA ligase Burkholderia multivorans (strain ATCC 17616 / 249)
Q2T087 0.000188 42 28 2 90 3 metG Methionine--tRNA ligase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4JGW6 0.000188 42 28 2 90 3 metG Methionine--tRNA ligase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B5ENA8 0.000224 42 30 3 93 3 metG Methionine--tRNA ligase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7Y5 0.000224 42 30 3 93 3 metG Methionine--tRNA ligase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q899D9 0.000232 42 33 4 106 3 metG Methionine--tRNA ligase Clostridium tetani (strain Massachusetts / E88)
Q63W90 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia pseudomallei (strain K96243)
A3N6Y1 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia pseudomallei (strain 668)
Q3JUY1 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia pseudomallei (strain 1710b)
A3NSL6 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia pseudomallei (strain 1106a)
A1V5W0 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia mallei (strain SAVP1)
Q62LE0 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia mallei (strain ATCC 23344)
A2SAF7 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia mallei (strain NCTC 10229)
A3MLM5 0.000256 42 27 2 97 3 metG Methionine--tRNA ligase Burkholderia mallei (strain NCTC 10247)
B5RPT6 0.000276 42 27 4 115 3 metG Methionine--tRNA ligase Borrelia recurrentis (strain A1)
O54873 0.000297 42 29 3 99 2 AIMP1 Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 Cricetulus griseus
B5RME0 0.000311 42 27 4 115 3 metG Methionine--tRNA ligase Borrelia duttonii (strain Ly)
Q0SMS1 0.000345 42 29 2 97 3 metG Methionine--tRNA ligase Borreliella afzelii (strain PKo)
Q0AES9 0.000354 42 28 3 97 3 metG Methionine--tRNA ligase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1SVA5 0.000368 42 36 3 87 3 metG Methionine--tRNA ligase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q12F12 0.000386 42 30 2 90 3 metG Methionine--tRNA ligase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q081H3 0.000393 42 31 2 86 3 metG Methionine--tRNA ligase Shewanella frigidimarina (strain NCIMB 400)
Q60CR0 0.000438 41 33 1 95 3 metG Methionine--tRNA ligase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1QVN7 0.000442 41 30 1 103 3 metG Methionine--tRNA ligase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q31GU1 0.000477 41 28 2 89 3 metG Methionine--tRNA ligase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A0KKF6 0.000486 41 29 2 96 3 metG Methionine--tRNA ligase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B0TJ05 0.000486 41 31 2 88 3 metG Methionine--tRNA ligase Shewanella halifaxensis (strain HAW-EB4)
A4IXI6 0.000525 41 29 1 92 3 metG Methionine--tRNA ligase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFE7 0.000525 41 29 1 92 3 metG Methionine--tRNA ligase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNA8 0.000525 41 29 1 92 3 metG Methionine--tRNA ligase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A4Y6 0.000525 41 29 1 92 3 metG Methionine--tRNA ligase Francisella tularensis subsp. holarctica (strain LVS)
A7NAE2 0.000525 41 29 1 92 3 metG Methionine--tRNA ligase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14GV0 0.000525 41 29 1 92 3 metG Methionine--tRNA ligase Francisella tularensis subsp. tularensis (strain FSC 198)
Q6DIJ1 0.000547 41 32 4 95 2 yars1 Tyrosine--tRNA ligase, cytoplasmic Xenopus tropicalis
Q21I21 0.000607 41 32 3 90 3 metG Methionine--tRNA ligase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5V1B3 0.000622 41 31 3 109 3 metG Methionine--tRNA ligase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
A0L8S1 0.000632 41 31 2 88 3 metG Methionine--tRNA ligase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A0Q556 0.000643 41 28 1 97 3 metG Methionine--tRNA ligase Francisella tularensis subsp. novicida (strain U112)
Q6TGS6 0.000657 41 28 1 81 2 yars1 Tyrosine--tRNA ligase, cytoplasmic Danio rerio
Q6MDG0 0.000671 41 29 2 88 3 metG Methionine--tRNA ligase Protochlamydia amoebophila (strain UWE25)
A9L4F6 0.000696 41 28 2 90 3 metG Methionine--tRNA ligase Shewanella baltica (strain OS195)
A3D5E5 0.000696 41 28 2 90 3 metG Methionine--tRNA ligase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q0HVY2 0.000702 41 27 2 90 3 metG Methionine--tRNA ligase Shewanella sp. (strain MR-7)
Q8EDX2 0.000702 41 27 2 90 3 metG Methionine--tRNA ligase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q39DV4 0.00072 41 27 2 90 3 metG Methionine--tRNA ligase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B7J2F0 0.000764 40 31 1 82 3 metG Methionine--tRNA ligase Borreliella burgdorferi (strain ZS7)
Q44951 0.000786 40 31 1 82 3 metG Methionine--tRNA ligase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B4E8E0 0.000816 40 27 2 90 3 metG Methionine--tRNA ligase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1JWS3 0.000848 40 27 2 90 3 metG Methionine--tRNA ligase Burkholderia orbicola (strain MC0-3)
Q1BUH6 0.000848 40 27 2 90 3 metG Methionine--tRNA ligase Burkholderia orbicola (strain AU 1054)
A0K9L0 0.000848 40 27 2 90 3 metG Methionine--tRNA ligase Burkholderia cenocepacia (strain HI2424)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05010
Feature type CDS
Gene -
Product tRNA-binding protein
Location 1095725 - 1096078 (strand: 1)
Length 354 (nucleotides) / 117 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_575
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01588 Putative tRNA binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0073 Translation, ribosomal structure and biogenesis (J) J tRNA-binding EMAP/Myf domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06878 tRNA-binding protein - -

Protein Sequence

MTDTTNTNTIEWDDFLRVEMRVGTIISAEINKKAKKPAYVMEVSLGELGTKRSSAQITVNYTPEELIGRRVLCVCNFPIKRIAGIKSEVLITGAADENGAIVLAEFNLPVPDGARLA

Flanking regions ( +/- flanking 50bp)

TTATTCGATAATCTTAATGAAGACATAGCAATAAAATAATAGGTAGCAAGATGACAGACACCACCAACACCAACACCATCGAATGGGATGACTTTTTACGGGTAGAAATGCGGGTTGGCACAATTATAAGTGCTGAAATAAATAAAAAAGCGAAGAAACCCGCTTATGTAATGGAAGTCAGCTTGGGAGAGCTGGGGACTAAACGCTCTAGTGCGCAAATCACCGTGAATTATACTCCTGAAGAGCTAATTGGTCGCCGAGTTTTATGTGTTTGCAATTTTCCTATTAAGCGGATTGCAGGGATCAAGTCTGAGGTGTTGATTACCGGGGCTGCTGATGAAAACGGTGCTATCGTTCTCGCAGAATTTAATTTACCTGTGCCTGATGGGGCTCGTTTAGCATGATCTATAGCTAATTGTCCTTTTCTTTTAACGCTCACAGCGATTTTGTTGTA