Homologs in group_575

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00930 FBDBKF_00930 87.6 Morganella morganii S1 csaA tRNA-binding protein
EHELCC_00615 EHELCC_00615 87.6 Morganella morganii S2 csaA tRNA-binding protein
NLDBIP_02845 NLDBIP_02845 87.6 Morganella morganii S4 csaA tRNA-binding protein
LHKJJB_04360 LHKJJB_04360 87.6 Morganella morganii S3 csaA tRNA-binding protein
HKOGLL_02685 HKOGLL_02685 87.6 Morganella morganii S5 csaA tRNA-binding protein
PMI_RS05010 PMI_RS05010 63.7 Proteus mirabilis HI4320 - tRNA-binding protein

Distribution of the homologs in the orthogroup group_575

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_575

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37584 1.73e-28 102 50 1 104 1 csaA Probable chaperone CsaA Bacillus subtilis (strain 168)
A5FLM7 4.08e-11 61 32 2 104 3 metG Methionine--tRNA ligase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q64MP7 1.44e-10 60 36 2 96 3 metG Methionine--tRNA ligase Bacteroides fragilis (strain YCH46)
Q5L7I8 1.47e-10 60 36 2 96 3 metG Methionine--tRNA ligase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8A3M1 3.44e-10 58 35 2 94 3 metG Methionine--tRNA ligase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B2RHF5 4.84e-10 58 35 2 95 3 metG Methionine--tRNA ligase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q4L3E7 1.05e-09 57 33 3 108 3 metG Methionine--tRNA ligase Staphylococcus haemolyticus (strain JCSC1435)
Q7MXK7 1.13e-09 57 35 2 95 3 metG Methionine--tRNA ligase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q724N6 3.03e-09 56 31 2 112 3 metG Methionine--tRNA ligase Listeria monocytogenes serotype 4b (strain F2365)
Q8YAF2 3.54e-09 56 33 2 103 3 metG Methionine--tRNA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9KGK8 3.75e-09 55 36 4 108 3 metG Methionine--tRNA ligase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q49UZ9 5.74e-09 55 33 3 109 3 metG Methionine--tRNA ligase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A6LFP0 5.76e-09 55 36 2 94 3 metG Methionine--tRNA ligase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A0M5Z9 7.95e-09 55 32 2 90 3 metG Methionine--tRNA ligase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q92F90 8.56e-09 55 30 2 112 3 metG Methionine--tRNA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P42589 1.09e-08 52 29 3 109 1 ygjH tRNA-binding protein YgjH Escherichia coli (strain K12)
Q8NY00 1.86e-08 53 33 3 109 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain MW2)
Q6GBZ8 1.86e-08 53 33 3 109 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain MSSA476)
A6UUN1 2.07e-08 53 30 2 97 3 metG Methionine--tRNA ligase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q6GJI1 2.49e-08 53 33 3 109 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain MRSA252)
P67579 2.49e-08 53 33 3 109 1 metG Methionine--tRNA ligase Staphylococcus aureus (strain N315)
P67578 2.49e-08 53 33 3 109 3 metG Methionine--tRNA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HII6 2.49e-08 53 33 3 109 1 metG Methionine--tRNA ligase Staphylococcus aureus (strain COL)
Q81W03 2.97e-08 53 36 3 103 3 metG1 Methionine--tRNA ligase 1 Bacillus anthracis
Q6MMA3 3.09e-08 53 35 2 93 3 metG Methionine--tRNA ligase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A6GVQ2 3.94e-08 53 30 2 94 3 metG Methionine--tRNA ligase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q8CQU3 4e-08 53 36 4 108 3 metG Methionine--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRR5 4e-08 53 36 4 108 3 metG Methionine--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B3H0J7 5.03e-08 52 35 1 97 3 metG Methionine--tRNA ligase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZ70 5.07e-08 52 35 1 97 3 metG Methionine--tRNA ligase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BTA2 5.12e-08 52 35 1 97 3 metG Methionine--tRNA ligase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q81JA8 5.31e-08 52 36 3 103 3 metG1 Methionine--tRNA ligase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A6VQD5 5.7e-08 52 34 3 110 3 metG Methionine--tRNA ligase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q480H5 5.84e-08 52 32 2 97 3 metG Methionine--tRNA ligase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B3ECI3 6.42e-08 52 36 3 95 3 metG Methionine--tRNA ligase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A9LZS9 7.2e-08 52 45 5 93 3 metG Methionine--tRNA ligase Neisseria meningitidis serogroup C (strain 053442)
Q9JWP0 7.71e-08 52 43 5 93 3 metG Methionine--tRNA ligase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F585 7.78e-08 52 43 5 93 3 metG Methionine--tRNA ligase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q58659 8.13e-08 52 29 2 95 3 metG Methionine--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9K1Q0 8.17e-08 52 43 5 93 3 metG Methionine--tRNA ligase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9RUF3 9.72e-08 52 29 2 103 3 metG Methionine--tRNA ligase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q46F18 9.95e-08 52 35 2 95 3 metG Methionine--tRNA ligase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q6LSZ7 1.14e-07 51 33 2 95 3 metG Methionine--tRNA ligase Photobacterium profundum (strain SS9)
A4SE77 1.55e-07 51 34 3 96 3 metG Methionine--tRNA ligase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A6KYR3 2.64e-07 50 33 2 105 3 metG Methionine--tRNA ligase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A4FZL1 3.93e-07 50 28 3 102 3 metG Methionine--tRNA ligase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A1KR57 4.01e-07 50 41 5 93 3 metG Methionine--tRNA ligase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A6URW2 4.08e-07 50 31 4 114 3 metG Methionine--tRNA ligase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q3SKG8 4.38e-07 50 34 1 86 3 metG Methionine--tRNA ligase Thiobacillus denitrificans (strain ATCC 25259)
P23395 5.22e-07 50 32 2 85 1 metG Methionine--tRNA ligase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q6M0E5 5.73e-07 49 27 3 102 3 metG Methionine--tRNA ligase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q8TIU5 6.94e-07 49 31 2 101 3 metG Methionine--tRNA ligase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q3B3N3 7.94e-07 49 33 3 96 3 metG Methionine--tRNA ligase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
O58721 7.96e-07 49 31 3 93 3 metG Methionine--tRNA ligase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V011 1.47e-06 48 30 3 93 1 metG Methionine--tRNA ligase Pyrococcus abyssi (strain GE5 / Orsay)
Q8D8F2 1.52e-06 48 32 2 93 3 metG Methionine--tRNA ligase Vibrio vulnificus (strain CMCP6)
Q7MM14 1.55e-06 48 32 2 93 3 metG Methionine--tRNA ligase Vibrio vulnificus (strain YJ016)
Q3AQR4 1.85e-06 48 32 2 94 3 metG Methionine--tRNA ligase Chlorobium chlorochromatii (strain CaD3)
A0B7K2 2.34e-06 48 33 3 104 3 metG Methionine--tRNA ligase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
B8F3E3 2.42e-06 48 33 1 95 3 metG Methionine--tRNA ligase Glaesserella parasuis serovar 5 (strain SH0165)
A6VIW5 2.53e-06 47 28 3 102 3 metG Methionine--tRNA ligase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
B3QT85 3.5e-06 47 32 3 92 3 metG Methionine--tRNA ligase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q54X95 3.59e-06 47 31 3 95 3 metS Probable methionine--tRNA ligase, cytoplasmic Dictyostelium discoideum
Q7VMC9 3.67e-06 47 32 1 97 3 metG Methionine--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8U221 3.69e-06 47 30 3 93 3 metG Methionine--tRNA ligase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q4FRS8 3.94e-06 47 33 2 96 3 metG Methionine--tRNA ligase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B2S0T6 4.48e-06 47 31 4 106 3 metG Methionine--tRNA ligase Borrelia hermsii (strain HS1 / DAH)
Q1D8K2 4.87e-06 47 32 1 86 3 metG Methionine--tRNA ligase Myxococcus xanthus (strain DK1622)
Q837B3 5.24e-06 47 28 2 106 3 metG Methionine--tRNA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
P37465 5.29e-06 47 31 3 108 3 metG Methionine--tRNA ligase Bacillus subtilis (strain 168)
Q74MZ1 5.68e-06 47 32 3 90 1 metG Methionine--tRNA ligase Nanoarchaeum equitans (strain Kin4-M)
Q65S22 6.14e-06 47 32 1 109 3 metG Methionine--tRNA ligase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2Y7P0 6.93e-06 46 31 2 99 3 metG Methionine--tRNA ligase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A5UBS8 7.03e-06 46 34 1 90 3 metG Methionine--tRNA ligase Haemophilus influenzae (strain PittEE)
A9FBU8 7.53e-06 46 32 1 83 3 metG1 Methionine--tRNA ligase 1 Sorangium cellulosum (strain So ce56)
Q1QAD0 7.54e-06 46 33 2 96 3 metG Methionine--tRNA ligase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
P23920 7.71e-06 46 32 2 110 3 metG Methionine--tRNA ligase Geobacillus stearothermophilus
Q9KT69 7.9e-06 46 32 2 97 3 metG Methionine--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2P8 8.29e-06 46 32 2 97 3 metG Methionine--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8PYJ4 1.03e-05 46 30 2 97 3 metG Methionine--tRNA ligase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P43828 1.1e-05 46 34 1 90 3 metG Methionine--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q12F12 1.11e-05 46 29 1 92 3 metG Methionine--tRNA ligase Polaromonas sp. (strain JS666 / ATCC BAA-500)
P57838 1.12e-05 46 32 1 90 3 metG Methionine--tRNA ligase Pasteurella multocida (strain Pm70)
A5UF42 1.12e-05 46 34 1 90 3 metG Methionine--tRNA ligase Haemophilus influenzae (strain PittGG)
Q660T5 1.18e-05 46 30 3 106 3 metG Methionine--tRNA ligase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
O33925 1.22e-05 45 30 3 89 3 metG Methionine--tRNA ligase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B6EIY5 1.26e-05 45 33 2 93 3 metG Methionine--tRNA ligase Aliivibrio salmonicida (strain LFI1238)
B6YUN0 1.27e-05 45 26 3 93 3 metG Methionine--tRNA ligase Thermococcus onnurineus (strain NA1)
A7I6H7 1.38e-05 45 33 2 84 3 metG Methionine--tRNA ligase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q0SMS1 1.45e-05 45 31 3 105 3 metG Methionine--tRNA ligase Borreliella afzelii (strain PKo)
Q2FU77 1.49e-05 45 29 4 110 3 metG Methionine--tRNA ligase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q9PP85 1.82e-05 45 28 2 104 3 metG Methionine--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1R019 1.85e-05 45 30 4 106 3 metG Methionine--tRNA ligase Borrelia turicatae (strain 91E135)
A5EY62 2.18e-05 45 28 2 99 3 metG Methionine--tRNA ligase Dichelobacter nodosus (strain VCS1703A)
Q8RDD1 2.39e-05 45 28 3 103 3 metG Methionine--tRNA ligase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q12UQ9 2.41e-05 45 33 2 95 3 metG Methionine--tRNA ligase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
B5ENA8 2.48e-05 45 31 2 86 3 metG Methionine--tRNA ligase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J7Y5 2.48e-05 45 31 2 86 3 metG Methionine--tRNA ligase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B1XWM2 3.49e-05 44 30 1 92 3 metG Methionine--tRNA ligase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q0I3W7 3.59e-05 44 32 1 103 3 metG Methionine--tRNA ligase Histophilus somni (strain 129Pt)
B0UV72 4.31e-05 44 32 1 103 3 metG Methionine--tRNA ligase Histophilus somni (strain 2336)
A1VKF9 4.41e-05 44 29 1 85 3 metG Methionine--tRNA ligase Polaromonas naphthalenivorans (strain CJ2)
A5WG58 4.53e-05 44 33 2 103 3 metG Methionine--tRNA ligase Psychrobacter sp. (strain PRwf-1)
B7J2F0 4.6e-05 44 30 3 105 3 metG Methionine--tRNA ligase Borreliella burgdorferi (strain ZS7)
Q44951 4.6e-05 44 30 3 105 3 metG Methionine--tRNA ligase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q5JDZ7 6.22e-05 43 26 3 93 3 metG Methionine--tRNA ligase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q0W0H2 7e-05 43 28 2 91 3 metG Methionine--tRNA ligase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
A4G3S6 7.3e-05 43 27 1 92 3 metG Methionine--tRNA ligase Herminiimonas arsenicoxydans
B0SQX5 7.79e-05 43 34 2 79 3 metG Methionine--tRNA ligase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SHA8 7.79e-05 43 34 2 79 3 metG Methionine--tRNA ligase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
P67581 8.73e-05 43 30 2 110 3 metG Methionine--tRNA ligase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67580 8.73e-05 43 30 2 110 3 metG Methionine--tRNA ligase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A1SVA5 8.75e-05 43 39 3 87 3 metG Methionine--tRNA ligase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q47IK0 8.76e-05 43 30 1 86 3 metG Methionine--tRNA ligase Dechloromonas aromatica (strain RCB)
Q31GU1 9.09e-05 43 30 2 95 3 metG Methionine--tRNA ligase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q4QJZ5 9.83e-05 43 33 1 90 3 metG Methionine--tRNA ligase Haemophilus influenzae (strain 86-028NP)
P59077 0.000134 43 29 2 101 3 metG Methionine--tRNA ligase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A6SX05 0.000142 43 28 1 92 3 metG Methionine--tRNA ligase Janthinobacterium sp. (strain Marseille)
A1TZ66 0.000153 42 34 2 83 3 metG Methionine--tRNA ligase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B5FG53 0.000196 42 33 2 93 3 metG Methionine--tRNA ligase Aliivibrio fischeri (strain MJ11)
Q21TB9 0.000204 42 26 1 89 3 metG Methionine--tRNA ligase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P56127 0.00023 42 29 1 86 3 metG Methionine--tRNA ligase Helicobacter pylori (strain ATCC 700392 / 26695)
A1BF81 0.000233 42 30 3 109 3 metG Methionine--tRNA ligase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q5E3Z7 0.000235 42 36 2 83 3 metG Methionine--tRNA ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6MDG0 0.00024 42 31 4 92 3 metG Methionine--tRNA ligase Protochlamydia amoebophila (strain UWE25)
Q8EZD6 0.000248 42 31 3 104 3 metG Methionine--tRNA ligase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q6DIJ1 0.000255 42 25 1 81 2 yars1 Tyrosine--tRNA ligase, cytoplasmic Xenopus tropicalis
Q72MR4 0.000265 42 31 3 104 3 metG Methionine--tRNA ligase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q0VP51 0.000267 42 35 1 88 3 metG Methionine--tRNA ligase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7ZX51 0.000267 42 25 1 81 2 yars1 Tyrosine--tRNA ligase, cytoplasmic Xenopus laevis
Q88Z97 0.000353 42 31 3 100 3 metG Methionine--tRNA ligase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B1KQM2 0.000353 42 34 3 94 3 metG Methionine--tRNA ligase Shewanella woodyi (strain ATCC 51908 / MS32)
Q12904 0.000395 41 23 2 110 1 AIMP1 Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 Homo sapiens
Q2KYS4 0.000425 41 29 1 85 3 metG Methionine--tRNA ligase Bordetella avium (strain 197N)
Q8TX28 0.000428 41 26 2 103 3 metG Methionine--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q21I21 0.000441 41 34 2 83 3 metG Methionine--tRNA ligase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A0L8S1 0.000442 41 32 2 96 3 metG Methionine--tRNA ligase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q9ZKG9 0.000471 41 29 1 86 3 metG Methionine--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
Q7URP3 0.000477 41 30 1 108 3 metG Methionine--tRNA ligase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1WBH1 0.000506 41 28 1 85 3 metG Methionine--tRNA ligase Acidovorax sp. (strain JS42)
Q4KM49 0.000507 41 29 1 85 2 Yars1 Tyrosine--tRNA ligase, cytoplasmic Rattus norvegicus
Q29465 0.000522 41 29 1 75 2 YARS1 Tyrosine--tRNA ligase, cytoplasmic Bos taurus
Q9ZTS1 0.000527 41 26 1 82 2 Os06g0508700 Probable methionine--tRNA ligase Oryza sativa subsp. japonica
Q0AES9 0.000537 41 29 3 92 3 metG Methionine--tRNA ligase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q9CHE0 0.000636 41 28 2 110 3 metG Methionine--tRNA ligase Lactococcus lactis subsp. lactis (strain IL1403)
Q91WQ3 0.000658 40 29 1 75 1 Yars1 Tyrosine--tRNA ligase, cytoplasmic Mus musculus
Q9SVN5 0.000665 41 25 1 86 2 At4g13780 Methionine--tRNA ligase, cytoplasmic Arabidopsis thaliana
B7VLW8 0.000813 40 32 2 93 3 metG Methionine--tRNA ligase Vibrio atlanticus (strain LGP32)
A1S798 0.000836 40 28 2 97 3 metG Methionine--tRNA ligase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q6TGS6 0.000864 40 26 1 75 2 yars1 Tyrosine--tRNA ligase, cytoplasmic Danio rerio
Q1LJN4 0.000879 40 27 1 85 3 metG Methionine--tRNA ligase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A3CX39 0.000884 40 30 2 83 3 metG Methionine--tRNA ligase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A8FWN7 0.001 40 34 3 94 3 metG Methionine--tRNA ligase Shewanella sediminis (strain HAW-EB3)
B9MEX0 0.001 40 28 1 85 3 metG Methionine--tRNA ligase Acidovorax ebreus (strain TPSY)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06925
Feature type CDS
Gene -
Product tRNA-binding protein
Location 1436676 - 1437017 (strand: -1)
Length 342 (nucleotides) / 113 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_575
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01588 Putative tRNA binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0073 Translation, ribosomal structure and biogenesis (J) J tRNA-binding EMAP/Myf domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06878 tRNA-binding protein - -

Protein Sequence

MTSAEIEWADFEKVEMRVATVLSAELNPKARKPAYIFTLDFGEFGIKTSSAQVTVLYNAGELIGRQVLCVCNFAPKRVAGVKSEVLITGVANADGDIVLAGFSLPVPNGHRLI

Flanking regions ( +/- flanking 50bp)

CAGCGGATAATATATACCCAACATCATTCAGGATGCAGGCAGGAAATACAATGACATCAGCAGAGATAGAATGGGCAGATTTTGAAAAAGTGGAAATGCGGGTCGCAACGGTACTGAGTGCGGAACTGAATCCGAAAGCCAGAAAACCCGCCTATATTTTCACCCTCGATTTCGGGGAATTCGGTATAAAAACCTCAAGTGCGCAGGTGACTGTGCTGTATAACGCCGGTGAACTGATCGGACGCCAGGTTTTGTGTGTCTGTAATTTCGCGCCTAAAAGAGTGGCCGGTGTGAAATCAGAAGTCTTAATCACAGGGGTGGCAAATGCGGACGGTGATATTGTCCTTGCCGGGTTCTCCCTGCCCGTACCCAATGGTCACCGCCTGATATAATCGCGGTTATGGCTTGTGCTTTTCTGTAAAATCGGGTCGAATGGGGTGTT