Homologs in group_3693

Help

3 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS00880 PMI_RS00880 40.9 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS02630 PMI_RS02630 66.0 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS17440 PMI_RS17440 36.9 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_3693

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3693

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04780
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 1050834 - 1051142 (strand: -1)
Length 309 (nucleotides) / 102 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3693
Orthogroup size 4
N. genomes 1

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042615 helix-turn-helix transcriptional regulator VF1235 Adherence

Protein Sequence

MINSTIAHKIKQRRKELRLTGIEMGNRLGISQQHYSRIENGNIKITVELLFSIAFILNMTPQSLLPNYNLLDKKIINLSDEKNIIKAKQALSAEFIIPIKEK

Flanking regions ( +/- flanking 50bp)

AGTTAATTGCTTTTAAAAAATGCTTTATAACCTTATAAAAATAGATGATCATGATAAACTCCACTATTGCACACAAAATAAAACAAAGAAGAAAAGAGTTAAGACTAACAGGCATAGAAATGGGAAATCGCTTAGGGATAAGCCAGCAACATTATTCTCGAATAGAAAATGGTAACATAAAAATCACGGTAGAACTTTTGTTTTCTATTGCATTTATTCTCAATATGACGCCACAAAGTTTATTACCTAATTATAATTTATTGGATAAAAAAATCATTAATCTTTCAGATGAGAAAAATATCATCAAAGCAAAACAGGCTTTATCTGCAGAATTTATTATACCAATAAAAGAAAAATAATGCCTTATACATATTATTTAACTTTATTCAAGAATAATTATTCTTTTTGC