Homologs in group_3682

Help

3 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS02630 PMI_RS02630 35.2 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS04780 PMI_RS04780 40.9 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator
PMI_RS17440 PMI_RS17440 28.2 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_3682

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3682

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P55681 7.44e-08 50 33 0 77 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P15017 1.93e-07 48 34 0 75 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P9WMH9 1.17e-05 44 40 0 64 1 Rv0474 Uncharacterized HTH-type transcriptional regulator Rv0474 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMH8 1.17e-05 44 40 0 64 4 MT0491 Uncharacterized HTH-type transcriptional regulator MT0491 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0C5S2 0.000307 40 33 1 65 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 0.000307 40 33 1 65 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P69202 0.000498 40 27 0 76 1 C2 Repressor protein C2 Salmonella phage P22
P06966 0.000776 39 30 1 79 4 dicA HTH-type transcriptional regulator DicA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00880
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 216179 - 216475 (strand: -1)
Length 297 (nucleotides) / 98 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3682
Orthogroup size 4
N. genomes 1

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MSKVYPISQIIGHKIRQQRQHLRLSAKAVAERVGVSQQQFSRYENGLCKIDVDMLFLIAKELNVTPTAFLPSPLNEDPIASSSAVTQSKLFWSAQSQI

Flanking regions ( +/- flanking 50bp)

GATATTTAATGAAATATTATCAGTAGTTGATAGGAGGAAAGAGGTCACCAATGTCAAAAGTTTATCCTATTTCTCAAATTATTGGACATAAAATTCGCCAACAGCGCCAACACTTACGTTTATCCGCTAAAGCAGTGGCTGAAAGAGTCGGCGTTAGCCAACAGCAATTTTCACGCTATGAGAATGGGCTATGTAAAATTGATGTTGATATGCTCTTCCTTATTGCTAAAGAATTAAATGTTACACCAACCGCTTTTCTTCCTTCACCGCTTAATGAAGATCCTATCGCTTCTTCAAGCGCTGTCACCCAATCTAAGCTATTTTGGAGCGCACAGAGTCAAATTTAATGACCTAAATAACCGTTAATTAGGATCTATAGTGAATTTTTTCGCAAAAG