Homologs in group_2465

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00160 FBDBKF_00160 66.2 Morganella morganii S1 ibpA Small heat shock protein IbpA, HSP20 family
EHELCC_01385 EHELCC_01385 66.2 Morganella morganii S2 ibpA Small heat shock protein IbpA, HSP20 family
NLDBIP_02075 NLDBIP_02075 66.2 Morganella morganii S4 ibpA Small heat shock protein IbpA, HSP20 family
LHKJJB_03590 LHKJJB_03590 66.2 Morganella morganii S3 ibpA Small heat shock protein IbpA, HSP20 family
HKOGLL_03455 HKOGLL_03455 66.2 Morganella morganii S5 ibpA Small heat shock protein IbpA, HSP20 family

Distribution of the homologs in the orthogroup group_2465

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2465

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P57640 9.64e-42 139 48 2 143 3 ibp Small heat shock protein ibp Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9Z616 2.43e-36 125 44 3 145 3 ibp Small heat shock protein ibp Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O31288 1.75e-31 113 43 2 149 3 ibp Small heat shock protein ibp Buchnera aphidicola subsp. Thelaxes suberi
P0DKS2 2.51e-24 94 41 2 124 3 ibp Small heat shock protein ibp Wigglesworthia glossinidia brevipalpis
A4W4S4 1.79e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Enterobacter sp. (strain 638)
Q8ZL03 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TMX6 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella schwarzengrund (strain CVM19633)
B5BIJ1 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella paratyphi A (strain AKU_12601)
A9MWJ6 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKS6 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SY76 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella newport (strain SL254)
B4TA60 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella heidelberg (strain SL476)
B5FMC8 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella dublin (strain CT_02021853)
Q57I25 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella choleraesuis (strain SC-B67)
B5EY83 2.35e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella agona (strain SL483)
Q8Z2L8 2.51e-20 84 36 1 105 3 ibpB Small heat shock protein IbpB Salmonella typhi
P0C060 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Shigella flexneri
Q0SYM9 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Shigella flexneri serotype 5b (strain 8401)
B1LL11 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli (strain SMS-3-5 / SECEC)
B6I3R9 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli (strain SE11)
B7NF03 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0C058 1.04e-19 82 37 1 105 1 ibpB Small heat shock protein IbpB Escherichia coli (strain K12)
B1IYQ8 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0C059 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A6E6 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O9:H4 (strain HS)
B1X9B6 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli (strain K12 / DH10B)
C4ZYW3 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4H5 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O8 (strain IAI1)
B7N2D2 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O81 (strain ED1a)
B5YX92 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XC04 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O157:H7
B7L830 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli (strain 55989 / EAEC)
B7MGA7 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMF3 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTP0 1.04e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O139:H28 (strain E24377A / ETEC)
B2TUT6 1.14e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5XT61 1.63e-19 82 34 1 105 3 ibpB Small heat shock protein IbpB Klebsiella pneumoniae (strain 342)
B7NQY6 2.09e-19 82 37 1 105 3 ibpB Small heat shock protein IbpB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A6TFY9 3.21e-19 81 32 2 131 3 ibpB Small heat shock protein IbpB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8ACJ9 5.55e-19 80 35 1 105 3 ibpB Small heat shock protein IbpB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C6DGL1 9.31e-18 77 34 3 123 3 ibpB Small heat shock protein IbpB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CYV3 9.43e-18 77 34 3 123 3 ibpB Small heat shock protein IbpB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G7R9 1.17e-17 77 31 2 122 3 ibpB Small heat shock protein IbpB Serratia proteamaculans (strain 568)
Q3YWC5 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Shigella sonnei (strain Ss046)
P0C057 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Shigella flexneri
Q0SYN0 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Shigella flexneri serotype 5b (strain 8401)
Q329C6 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Shigella dysenteriae serotype 1 (strain Sd197)
Q31UU6 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Shigella boydii serotype 4 (strain Sb227)
B2TUT5 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LK29 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LL12 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain SMS-3-5 / SECEC)
B6I3S0 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain SE11)
B7NF04 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0C054 1.74e-16 74 30 2 123 1 ibpA Small heat shock protein IbpA Escherichia coli (strain K12)
B1IYQ7 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0C056 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TB20 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHM2 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O1:K1 / APEC
A8A6E7 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O9:H4 (strain HS)
B1X9B7 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain K12 / DH10B)
C4ZYW4 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4H6 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O8 (strain IAI1)
B7N1Z1 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O81 (strain ED1a)
B7NQY7 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YX93 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0C055 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O157:H7
B7L831 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain 55989 / EAEC)
B7MGA8 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMF4 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTP1 1.74e-16 74 30 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O139:H28 (strain E24377A / ETEC)
B1JGZ6 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663W9 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGM7 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pestis (strain Pestoides F)
Q1CD75 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4H1 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9V6 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pestis
B2K7E6 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3K9 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPA7 2.97e-16 73 30 3 123 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
O86110 4.58e-16 73 30 2 123 3 hspH Small heat shock protein HspH Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7CPF1 4.66e-16 73 30 2 123 3 ibpA Small heat shock protein IbpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGW7 4.66e-16 73 30 2 123 3 ibpA Small heat shock protein IbpA Salmonella typhi
B4TMX7 4.66e-16 73 30 2 123 3 ibpA Small heat shock protein IbpA Salmonella schwarzengrund (strain CVM19633)
B5BIJ2 4.66e-16 73 30 2 123 3 ibpA Small heat shock protein IbpA Salmonella paratyphi A (strain AKU_12601)
A9MWJ7 4.66e-16 73 30 2 123 3 ibpA Small heat shock protein IbpA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKS5 4.66e-16 73 30 2 123 3 ibpA Small heat shock protein IbpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57I24 4.66e-16 73 30 2 123 3 ibpA Small heat shock protein IbpA Salmonella choleraesuis (strain SC-B67)
P70917 4.73e-16 73 30 2 126 3 hspA Small heat shock protein HspA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O69241 5.1e-16 73 35 1 102 3 hspD Small heat shock protein HspD Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8ACK0 7.01e-16 72 30 2 123 3 ibpA Small heat shock protein IbpA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XT60 7.39e-16 72 30 2 123 3 ibpA Small heat shock protein IbpA Klebsiella pneumoniae (strain 342)
P70918 3.84e-14 68 29 3 133 3 hspB Small heat shock protein HspB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8G7R8 3.92e-14 68 30 2 123 3 ibpA Small heat shock protein IbpA Serratia proteamaculans (strain 568)
B1JGZ5 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663X0 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGM6 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis (strain Pestoides F)
Q1CD74 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4H2 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9V5 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis
B2K7E5 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3L0 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPA8 6.27e-14 67 29 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
O69242 7.41e-14 67 32 1 103 3 hspE Small heat shock protein HspE Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C6DGL0 1.15e-13 67 29 2 124 3 ibpA Small heat shock protein IbpA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CYV2 1.15e-13 67 29 2 124 3 ibpA Small heat shock protein IbpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P96193 6.38e-13 65 29 3 134 3 ibpB 16 kDa heat shock protein B Azotobacter vinelandii
P19244 3.38e-08 53 28 5 135 2 HSP22.7 22.7 kDa class IV heat shock protein Pisum sativum
P05478 4.53e-07 50 27 6 145 3 HSP18.5-C 18.5 kDa class I heat shock protein Glycine max
P04795 6.18e-07 49 30 4 101 3 HSP17.6-L 17.6 kDa class I heat shock protein Glycine max
P27879 1.15e-06 48 25 4 132 2 HSP18.1 18.1 kDa class I heat shock protein (Fragment) Medicago sativa
O74984 1.24e-06 48 28 5 138 3 SPCC338.06c Heat shock protein homolog C338.06c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P13853 1.33e-06 48 27 5 140 2 HSP17.6C 17.6 kDa class I heat shock protein 3 Arabidopsis thaliana
Q84J50 1.83e-06 48 31 2 95 2 HSP17.7 17.7 kDa class I heat shock protein Oryza sativa subsp. japonica
P04794 3.52e-06 47 30 4 105 3 HSP17.5-E 17.5 kDa class I heat shock protein Glycine max
P27880 5.25e-06 47 25 5 144 2 HSP18.2 18.2 kDa class I heat shock protein Medicago sativa
Q38806 5.97e-06 47 26 3 138 2 HSP22.0 22.0 kDa heat shock protein Arabidopsis thaliana
P04793 7.77e-06 46 26 5 152 3 HSP17.5-M 17.5 kDa class I heat shock protein Glycine max
P12810 9.26e-06 46 26 5 138 2 hsp16.9A 16.9 kDa class I heat shock protein 1 Triticum aestivum
P27777 1.35e-05 45 38 2 68 1 HSP16.9A 16.9 kDa class I heat shock protein 1 Oryza sativa subsp. japonica
Q943E7 1.66e-05 45 36 2 68 2 HSP16.9C 16.9 kDa class I heat shock protein 3 Oryza sativa subsp. japonica
P31170 1.81e-05 46 27 6 138 1 HSP21 Heat shock protein 21, chloroplastic Arabidopsis thaliana
Q943E6 2.1e-05 45 36 2 68 2 HSP16.9B 16.9 kDa class I heat shock protein 2 Oryza sativa subsp. japonica
P81958 3.92e-05 44 29 2 98 1 PAM_028 Probable Hsp20 family chaperone Onion yellows phytoplasma (strain OY-M)
Q92IQ7 3.95e-05 44 29 7 137 3 hspC1 Small heat shock protein C1 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9LNW0 4.49e-05 44 29 3 89 1 HSP17.8 17.8 kDa class I heat shock protein Arabidopsis thaliana
Q84Q77 4.9e-05 44 29 4 111 1 HSP17.9A 17.9 kDa class I heat shock protein Oryza sativa subsp. japonica
O14368 5.39e-05 43 29 8 158 1 hsp16 Heat shock protein 16 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q84Q72 0.000104 43 28 3 121 2 HSP18.1 18.1 kDa class I heat shock protein Oryza sativa subsp. japonica
Q05832 0.000114 43 36 2 74 2 HSP18 18.3 kDa class I heat shock protein Oxybasis rubra
Q41560 0.00016 42 25 6 145 1 hsp16.9B 16.9 kDa class I heat shock protein 2 Triticum aestivum
A5JV83 0.000178 43 30 5 110 2 hspb11 Heat shock protein beta-11 Danio rerio
Q95661 0.000184 43 27 6 142 2 HSP21 Small heat shock protein, chloroplastic Solanum lycopersicum
P30222 0.000193 43 25 6 140 2 HSP22 Small heat shock protein, chloroplastic Petunia hybrida
P30693 0.000212 42 27 7 149 2 HSP17.6 17.6 kDa class I heat shock protein Helianthus annuus
Q9ZW31 0.000228 42 39 1 58 2 HSP17.6B 17.6 kDa class I heat shock protein 2 Arabidopsis thaliana
P02519 0.000239 42 26 3 92 3 HSP17.3-B 17.3 kDa class I heat shock protein Glycine max
P31673 0.000265 42 35 1 74 2 HSP17.4 17.4 kDa class I heat shock protein Oryza sativa subsp. japonica
Q943Q3 0.000271 42 30 5 98 2 HSP16.6 16.6 kDa heat shock protein Oryza sativa subsp. japonica
Q9SSQ8 0.000451 42 24 4 145 2 HSP26.5 26.5 kDa heat shock protein, mitochondrial Arabidopsis thaliana
Q4UJB1 0.000495 41 26 2 119 3 hspc4-1 Small heat shock protein C4 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P27396 0.000525 41 35 1 59 3 None 17.8 kDa class I heat shock protein Daucus carota
P30221 0.000591 41 29 2 95 2 None 17.8 kDa class I heat shock protein Solanum lycopersicum
P19037 0.000598 41 37 1 56 1 HSP18.1 18.1 kDa class I heat shock protein Arabidopsis thaliana
Q9XIE3 0.00066 41 28 3 89 1 HSP17.6A 17.6 kDa class I heat shock protein 1 Arabidopsis thaliana
P30236 0.001 41 26 7 156 3 HSP22.0 22.0 kDa class IV heat shock protein Glycine max

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04750
Feature type CDS
Gene -
Product Hsp20 family protein
Location 1046145 - 1046603 (strand: 1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2465
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00011 Hsp20/alpha crystallin family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0071 Posttranslational modification, protein turnover, chaperones (O) O Small heat shock protein IbpA, HSP20 family

Protein Sequence

MPNIKPFSLFPTLSDNLLSNRFDQIDRLFSQLTGSKPISSPTQTYNLKQIDDNHYELTVSVPGYQEDDLSVSLKGSRLLIEGKKEEKLEEDNDKWIHRGISQGQFTLQFDLGKNVKIEKADLSSGLLTIAIEYELPEEEKRQTIAIENKDKS

Flanking regions ( +/- flanking 50bp)

GGCCAATCAGATATCGCCCATAATTCAATAAATACTGAAGGAGGAATTATATGCCTAATATTAAACCTTTTTCATTATTCCCAACTTTATCTGACAATCTACTTTCAAACCGTTTTGATCAGATAGATCGCCTGTTTAGTCAGTTAACAGGCAGTAAACCAATTTCATCACCGACTCAGACTTATAATCTGAAACAGATTGATGATAACCATTATGAACTAACAGTGAGTGTGCCTGGATATCAAGAAGATGACTTATCGGTTTCATTGAAAGGAAGTCGCTTATTGATTGAAGGGAAAAAAGAAGAAAAATTAGAAGAAGACAATGATAAATGGATCCACCGAGGTATATCTCAAGGGCAGTTTACATTGCAGTTTGACCTCGGTAAAAATGTCAAAATAGAAAAAGCCGATTTATCAAGTGGACTTCTGACCATTGCTATTGAATATGAGTTACCTGAAGAAGAAAAACGGCAAACAATAGCGATAGAAAATAAAGATAAAAGCTAATTTAGTGAGATAGCTTAAATAAGATTAAGGCTGCACATAATGTGTAGCCT