Homologs in group_2465

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00160 FBDBKF_00160 100.0 Morganella morganii S1 ibpA Small heat shock protein IbpA, HSP20 family
EHELCC_01385 EHELCC_01385 100.0 Morganella morganii S2 ibpA Small heat shock protein IbpA, HSP20 family
NLDBIP_02075 NLDBIP_02075 100.0 Morganella morganii S4 ibpA Small heat shock protein IbpA, HSP20 family
LHKJJB_03590 LHKJJB_03590 100.0 Morganella morganii S3 ibpA Small heat shock protein IbpA, HSP20 family
PMI_RS04750 PMI_RS04750 66.2 Proteus mirabilis HI4320 - Hsp20 family protein

Distribution of the homologs in the orthogroup group_2465

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2465

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P57640 1.01e-45 149 50 1 141 3 ibp Small heat shock protein ibp Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9Z616 2.44e-35 123 39 2 143 3 ibp Small heat shock protein ibp Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O31288 2.1e-30 110 44 3 149 3 ibp Small heat shock protein ibp Buchnera aphidicola subsp. Thelaxes suberi
P0DKS2 9.45e-29 105 44 1 123 3 ibp Small heat shock protein ibp Wigglesworthia glossinidia brevipalpis
A4W4S4 3.33e-24 94 36 3 124 3 ibpB Small heat shock protein IbpB Enterobacter sp. (strain 638)
Q8ZL03 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TMX6 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella schwarzengrund (strain CVM19633)
B5BIJ1 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella paratyphi A (strain AKU_12601)
A9MWJ6 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKS6 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SY76 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella newport (strain SL254)
B4TA60 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella heidelberg (strain SL476)
B5FMC8 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella dublin (strain CT_02021853)
Q57I25 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella choleraesuis (strain SC-B67)
B5EY83 5.47e-23 91 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella agona (strain SL483)
Q8Z2L8 6.03e-23 90 36 2 124 3 ibpB Small heat shock protein IbpB Salmonella typhi
A8ACJ9 8.34e-23 90 36 2 124 3 ibpB Small heat shock protein IbpB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0C060 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Shigella flexneri
Q0SYM9 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Shigella flexneri serotype 5b (strain 8401)
B1LL11 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli (strain SMS-3-5 / SECEC)
B6I3R9 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli (strain SE11)
B7NF03 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0C058 5.52e-22 88 35 1 133 1 ibpB Small heat shock protein IbpB Escherichia coli (strain K12)
B1IYQ8 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0C059 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A6E6 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O9:H4 (strain HS)
B1X9B6 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli (strain K12 / DH10B)
C4ZYW3 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4H5 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O8 (strain IAI1)
B7N2D2 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O81 (strain ED1a)
B5YX92 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XC04 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O157:H7
B7L830 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli (strain 55989 / EAEC)
B7MGA7 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMF3 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTP0 5.52e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O139:H28 (strain E24377A / ETEC)
B1JGZ6 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663W9 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGM7 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pestis (strain Pestoides F)
Q1CD75 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4H1 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9V6 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pestis
B2K7E6 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3K9 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPA7 7.33e-22 88 33 2 121 3 ibpB Small heat shock protein IbpB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2TUT6 7.38e-22 88 35 1 133 3 ibpB Small heat shock protein IbpB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7NQY6 1.17e-21 87 35 1 133 3 ibpB Small heat shock protein IbpB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A6TFY9 1.49e-21 87 35 2 124 3 ibpB Small heat shock protein IbpB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XT61 1.62e-21 87 36 2 106 3 ibpB Small heat shock protein IbpB Klebsiella pneumoniae (strain 342)
C6DGL1 1.38e-20 85 32 2 121 3 ibpB Small heat shock protein IbpB Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CYV3 1.47e-20 85 32 2 122 3 ibpB Small heat shock protein IbpB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P96193 1.34e-19 82 31 2 137 3 ibpB 16 kDa heat shock protein B Azotobacter vinelandii
B5XT60 2.66e-19 81 34 2 123 3 ibpA Small heat shock protein IbpA Klebsiella pneumoniae (strain 342)
A8G7R9 3.65e-19 81 31 3 122 3 ibpB Small heat shock protein IbpB Serratia proteamaculans (strain 568)
Q3YWC5 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Shigella sonnei (strain Ss046)
P0C057 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Shigella flexneri
Q0SYN0 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Shigella flexneri serotype 5b (strain 8401)
Q329C6 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Shigella dysenteriae serotype 1 (strain Sd197)
Q31UU6 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Shigella boydii serotype 4 (strain Sb227)
B2TUT5 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LK29 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LL12 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain SMS-3-5 / SECEC)
B6I3S0 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain SE11)
B7NF04 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0C054 4.85e-19 80 33 2 123 1 ibpA Small heat shock protein IbpA Escherichia coli (strain K12)
B1IYQ7 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0C056 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TB20 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AHM2 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O1:K1 / APEC
A8A6E7 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O9:H4 (strain HS)
B1X9B7 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain K12 / DH10B)
C4ZYW4 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M4H6 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O8 (strain IAI1)
B7N1Z1 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O81 (strain ED1a)
B7NQY7 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YX93 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0C055 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O157:H7
B7L831 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli (strain 55989 / EAEC)
B7MGA8 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMF4 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTP1 4.85e-19 80 33 2 123 3 ibpA Small heat shock protein IbpA Escherichia coli O139:H28 (strain E24377A / ETEC)
A8ACK0 2.03e-18 79 33 2 123 3 ibpA Small heat shock protein IbpA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7CPF1 1.23e-17 77 32 2 123 3 ibpA Small heat shock protein IbpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGW7 1.23e-17 77 32 2 123 3 ibpA Small heat shock protein IbpA Salmonella typhi
B4TMX7 1.23e-17 77 32 2 123 3 ibpA Small heat shock protein IbpA Salmonella schwarzengrund (strain CVM19633)
B5BIJ2 1.23e-17 77 32 2 123 3 ibpA Small heat shock protein IbpA Salmonella paratyphi A (strain AKU_12601)
A9MWJ7 1.23e-17 77 32 2 123 3 ibpA Small heat shock protein IbpA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKS5 1.23e-17 77 32 2 123 3 ibpA Small heat shock protein IbpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57I24 1.23e-17 77 32 2 123 3 ibpA Small heat shock protein IbpA Salmonella choleraesuis (strain SC-B67)
O69241 3.6e-17 76 32 2 123 3 hspD Small heat shock protein HspD Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8G7R8 1.17e-16 74 29 4 147 3 ibpA Small heat shock protein IbpA Serratia proteamaculans (strain 568)
B1JGZ5 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q663X0 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGM6 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis (strain Pestoides F)
Q1CD74 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4H2 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis bv. Antiqua (strain Angola)
Q8Z9V5 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis
B2K7E5 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3L0 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPA8 2.2e-15 71 31 2 124 3 ibpA Small heat shock protein IbpA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DGL0 4.04e-15 70 30 3 124 3 ibpA Small heat shock protein IbpA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CYV2 4.04e-15 70 30 3 124 3 ibpA Small heat shock protein IbpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P70918 2.23e-14 69 28 2 124 3 hspB Small heat shock protein HspB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P70917 1.39e-13 67 27 2 126 3 hspA Small heat shock protein HspA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O86110 2.59e-13 66 29 3 123 3 hspH Small heat shock protein HspH Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O69242 2.57e-12 63 26 1 104 3 hspE Small heat shock protein HspE Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9SSQ8 0.000511 42 28 5 141 2 HSP26.5 26.5 kDa heat shock protein, mitochondrial Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03455
Feature type CDS
Gene ibpA
Product Small heat shock protein IbpA, HSP20 family
Location 281791 - 282249 (strand: 1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession ZDB_680
Length 282413 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2465
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00011 Hsp20/alpha crystallin family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0071 Posttranslational modification, protein turnover, chaperones (O) O Small heat shock protein IbpA, HSP20 family

Protein Sequence

MQNISSFSLFPALSDSLLSNRFDQMDRLFSQLTGNRPITSEHPYNLKQLNDAHYQLTVSVPGYREDDLEVSLKGGKLSIQGKQPAEVVNESEKWVHQGILKSQFSLEFNLGKNVKIRNAELSCGLLTLDIEYEIPEEEKPQLIAIENKDIKA

Flanking regions ( +/- flanking 50bp)

ACCATGATGTGTATTTAAAAAGAATAAATTGAAATACTGAAGGAGGAATTATGCAGAACATTAGTTCTTTTTCATTATTTCCGGCATTATCTGATAGTTTGCTGTCAAATCGCTTTGACCAGATGGACCGTTTATTCAGTCAACTTACGGGCAACAGGCCAATAACCTCAGAACATCCATATAACCTGAAGCAATTAAATGATGCGCACTATCAACTGACGGTTAGTGTTCCCGGATACAGGGAAGATGATCTTGAGGTATCATTGAAAGGTGGCAAACTTAGTATTCAGGGTAAACAACCTGCAGAAGTAGTTAATGAATCAGAGAAATGGGTACACCAAGGGATATTAAAAAGCCAGTTTTCATTAGAATTTAACCTTGGTAAGAATGTCAAAATTCGGAATGCAGAATTATCCTGCGGATTGCTGACATTGGATATAGAGTATGAAATTCCGGAAGAAGAAAAACCACAGTTGATAGCTATTGAAAATAAAGATATAAAGGCTTAGTTTCTGATTTTTTGTTCCAAACCCGCCAATATTGGCGGGGTTTTTAAAGC