Homologs in group_1952

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14650 FBDBKF_14650 84.3 Morganella morganii S1 ndh NADH dehydrogenase, FAD-containing subunit
EHELCC_15455 EHELCC_15455 84.3 Morganella morganii S2 ndh NADH dehydrogenase, FAD-containing subunit
NLDBIP_15985 NLDBIP_15985 84.3 Morganella morganii S4 ndh NADH dehydrogenase, FAD-containing subunit
LHKJJB_15855 LHKJJB_15855 84.3 Morganella morganii S3 ndh NADH dehydrogenase, FAD-containing subunit
HKOGLL_14975 HKOGLL_14975 84.3 Morganella morganii S5 ndh NADH dehydrogenase, FAD-containing subunit
F4V73_RS07445 F4V73_RS07445 83.3 Morganella psychrotolerans - NAD(P)/FAD-dependent oxidoreductase

Distribution of the homologs in the orthogroup group_1952

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1952

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P00393 0.0 687 79 1 433 1 ndh Type II NADH:quinone oxidoreductase Escherichia coli (strain K12)
P44856 1.48e-167 481 54 2 430 3 ndh Type II NADH:quinone oxidoreductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q49W80 3.18e-42 156 29 12 390 3 SSP1834 Type II NADH:quinone oxidoreductase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2YWP9 1.46e-41 155 31 13 390 3 SAB0807 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GIE7 1.69e-41 154 31 13 390 3 SAR0903 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain MRSA252)
Q7A6J4 1.69e-41 154 31 13 390 1 SA0802 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain N315)
Q99VE0 1.69e-41 154 31 13 390 3 None Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHE4 1.69e-41 154 31 13 390 3 SACOL0944 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain COL)
Q2FZV7 1.69e-41 154 31 13 390 1 SAOUHSC_00878 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FID4 1.69e-41 154 31 13 390 3 SAUSA300_0844 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300)
Q8NXG0 1.91e-40 152 30 13 390 3 MW0823 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain MW2)
Q6GAY5 1.91e-40 152 30 13 390 3 SAS0811 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain MSSA476)
Q8CPV5 1.26e-39 149 29 12 389 3 SE_0635 Type II NADH:quinone oxidoreductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQM1 4.82e-39 148 28 11 388 3 SERP0527 Type II NADH:quinone oxidoreductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P95160 1.79e-38 147 27 9 428 1 ndh Type II NADH:quinone oxidoreductase Ndh Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P95200 3.1e-37 144 26 10 421 1 ndhA Type II NADH:quinone oxidoreductase NdhA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4L4V6 6.94e-37 142 28 12 390 3 SH2010 Type II NADH:quinone oxidoreductase Staphylococcus haemolyticus (strain JCSC1435)
P73735 7.85e-34 134 29 12 413 1 ndbB Demethylphylloquinone reductase NdbB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
M1BYJ7 1.75e-33 135 29 11 336 3 NDB1 External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial Solanum tuberosum
P80861 9.71e-33 130 29 8 377 1 yjlD NADH dehydrogenase-like protein YjlD Bacillus subtilis (strain 168)
Q9ST62 1.67e-32 132 29 11 331 1 NDB1 External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial Solanum tuberosum
O05267 7.06e-32 128 29 12 392 3 yumB NADH dehydrogenase-like protein YumB Bacillus subtilis (strain 168)
Q1JPL4 5.89e-31 128 28 11 336 1 NDB1 External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial Arabidopsis thaliana
O32117 2.18e-30 123 26 12 407 3 yutJ NADH dehydrogenase-like protein YutJ Bacillus subtilis (strain 168)
Q55CD9 3.19e-29 122 25 10 406 3 DDB_G0270104 Probable NADH dehydrogenase Dictyostelium discoideum
O43090 7.04e-27 116 25 10 361 3 SPBC947.15c Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
F4JJJ3 1.97e-26 115 31 11 329 2 NDB3 External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial Arabidopsis thaliana
Q94BV7 1.56e-24 109 30 12 330 1 NDB2 External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial Arabidopsis thaliana
Q9SKT7 2.78e-23 105 29 13 331 1 NDB4 External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial Arabidopsis thaliana
O14121 5.43e-20 95 25 9 351 3 SPAC3A11.07 Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8GXR9 9.12e-20 95 25 12 414 1 NDC1 Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial Arabidopsis thaliana
F2Z699 1.9e-19 94 25 10 354 1 NDH2 External alternative NADH-ubiquinone oxidoreductase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
P40215 2.26e-19 94 29 12 348 1 NDE1 External NADH-ubiquinone oxidoreductase 1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P32340 1.32e-17 88 25 14 447 1 NDI1 Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O80874 1.34e-17 88 23 11 427 1 NDA2 Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial Arabidopsis thaliana
M0ZYF3 6.64e-15 80 25 15 428 3 NDA1 Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial Solanum tuberosum
Q9ST63 1.38e-14 79 24 13 427 1 NDA1 Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial Solanum tuberosum
Q8GWA1 2.61e-14 78 22 13 425 2 NDA1 Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial Arabidopsis thaliana
Q07500 5.34e-14 77 25 13 349 1 NDE2 External NADH-ubiquinone oxidoreductase 2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q54NS8 1.28e-12 72 26 15 342 3 aifB Apoptosis-inducing factor homolog B Dictyostelium discoideum
A0A067XMP1 7.22e-12 70 26 17 372 2 ptaL Oxidoreductase ptaL Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q6D8S1 8.05e-12 70 25 14 370 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TCX6 4.47e-11 67 27 15 353 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q0VTB0 8.99e-11 67 27 9 254 1 rubB Rubredoxin-NAD(+) reductase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3YYF3 1.15e-10 66 27 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella sonnei (strain Ss046)
Q8FEN4 1.82e-10 65 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32CL7 1.87e-10 65 26 15 352 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella dysenteriae serotype 1 (strain Sd197)
A8A3I8 2.39e-10 65 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O9:H4 (strain HS)
A7ZQE0 2.47e-10 65 26 15 352 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TEG9 2.52e-10 65 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UHC3 3.07e-10 65 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1R7Y9 3.24e-10 65 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain UTI89 / UPEC)
A1AEQ1 3.24e-10 65 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O1:K1 / APEC
B7MKI0 3.24e-10 65 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O45:K1 (strain S88 / ExPEC)
B5Z372 3.48e-10 65 26 15 352 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X850 3.48e-10 65 26 15 352 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O157:H7
B5XVA0 3.71e-10 65 26 15 353 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Klebsiella pneumoniae (strain 342)
B7MYL1 3.84e-10 64 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O81 (strain ED1a)
B7M9E8 4.44e-10 64 26 15 352 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O8 (strain IAI1)
B7LEC2 4.44e-10 64 26 15 352 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain 55989 / EAEC)
B6I697 4.99e-10 64 26 15 352 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain SE11)
P37596 7.4e-10 63 26 14 354 1 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12)
B1IUW8 7.4e-10 63 26 14 354 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XCN8 7.4e-10 63 26 14 354 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12 / DH10B)
C4ZYV6 7.4e-10 63 26 14 354 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12 / MC4100 / BW2952)
B7NSJ1 8.1e-10 63 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LQ29 1.4e-09 63 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain SMS-3-5 / SECEC)
Q8D4F7 1.41e-09 63 23 12 342 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Vibrio vulnificus (strain CMCP6)
B2U036 1.57e-09 63 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q58065 3.1e-09 62 24 14 319 3 MJ0649 NADH oxidase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P59403 4.73e-09 61 27 16 353 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella flexneri
Q0T1D6 4.73e-09 61 27 16 353 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella flexneri serotype 5b (strain 8401)
Q8U1K9 7.13e-09 60 23 17 379 1 PF1197 NAD(P)H:rubredoxin oxidoreductase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B7LW23 1.5e-08 60 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A1A653 1.76e-08 59 27 13 285 2 fer8 Fe-regulated protein 8 Ustilago maydis (strain 521 / FGSC 9021)
B5FG80 1.82e-08 59 26 9 260 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aliivibrio fischeri (strain MJ11)
A4WDR7 1.94e-08 59 27 16 343 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Enterobacter sp. (strain 638)
B7N6U1 4.53e-08 58 26 14 349 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q7MFY7 1e-07 57 23 12 342 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Vibrio vulnificus (strain YJ016)
A9MFX5 1.26e-07 57 24 14 342 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P16640 1.43e-07 57 26 10 232 1 camA Putidaredoxin reductase CamA Pseudomonas putida
A0A142C7A5 1.89e-07 56 26 7 261 1 phnG Oxidoreductase phnG Penicillium herquei
Q54NS9 2.29e-07 56 25 10 229 3 aifA Apoptosis-inducing factor homolog A Dictyostelium discoideum
B5F365 2.62e-07 56 24 13 347 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella agona (strain SL483)
A5W4E9 8.15e-07 54 25 15 335 1 todA Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B4TT18 1e-06 54 24 13 343 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella schwarzengrund (strain CVM19633)
B5RDG6 1.06e-06 54 24 14 343 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q06458 2.9e-06 53 29 7 161 3 nasB Nitrite reductase [NAD(P)H] large subunit Klebsiella oxytoca
P42454 3.65e-06 52 24 13 353 1 rubB Rubredoxin-NAD(+) reductase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P42435 1.67e-05 50 26 10 260 2 nasD Nitrite reductase [NAD(P)H] Bacillus subtilis (strain 168)
P37337 2.13e-05 50 27 7 177 3 bphG Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component Paraburkholderia xenovorans (strain LB400)
P43494 2.42e-05 50 24 15 328 1 thcD Rhodocoxin reductase Rhodococcus erythropolis
B5FXE5 2.5e-05 50 23 14 368 2 AIFM2 Ferroptosis suppressor protein 1 Taeniopygia guttata
Q07946 4.02e-05 49 23 11 344 1 bedA Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit Pseudomonas putida
P08201 5.64e-05 49 27 3 119 3 nirB Nitrite reductase (NADH) large subunit Escherichia coli (strain K12)
Q9LK94 6.07e-05 48 25 10 224 1 MDAR4 Monodehydroascorbate reductase 4, peroxisomal Arabidopsis thaliana
W8X9R5 7.3e-05 48 25 12 328 1 ctmF Probable ferredoxin reductase CtmF Castellaniella defragrans (strain DSM 12143 / CCUG 39792 / 65Phen)
A4STH3 0.000148 47 26 8 215 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aeromonas salmonicida (strain A449)
A0KEJ2 0.000152 47 25 8 220 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q51973 0.000243 47 27 20 345 1 cmtAa p-cumate 2,3-dioxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas putida
P38681 0.000259 47 32 4 116 2 nit-6 Nitrite reductase [NAD(P)H] Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q50068 0.000496 45 27 7 155 3 lpd Dihydrolipoyl dehydrogenase Mycobacterium leprae (strain TN)
B7N6C9 0.000562 45 24 9 235 3 hcaD 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P9WJJ1 0.000701 45 24 4 207 1 Rv1812c NADH dehydrogenase-like protein Rv1812c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJJ0 0.000701 45 24 4 207 2 MT1860 NADH dehydrogenase-like protein MT1860 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O24679 0.000725 45 25 8 218 1 tecA4 Chlorobenzene dioxygenase, ferredoxin reductase component Cupriavidus sp. (strain PS12)
P42433 0.000842 45 25 10 249 2 nasB Assimilatory nitrate reductase electron transfer subunit Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04295
Feature type CDS
Gene -
Product NAD(P)/FAD-dependent oxidoreductase
Location 962466 - 963773 (strand: 1)
Length 1308 (nucleotides) / 435 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1952
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07992 Pyridine nucleotide-disulphide oxidoreductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1252 Energy production and conversion (C) C NADH dehydrogenase, FAD-containing subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03885 NADH:quinone reductase (non-electrogenic) [EC:1.6.5.9] Oxidative phosphorylation
Metabolic pathways		 -

Protein Sequence

MSLTKIVIVGGGAGGLELATKLGDKLGRKKKAEITLVDRNNSHLWKPLLHEVATGSLDDGVDALSYLAHGYNHHFNFQLGTLTGLDRQHKNITLAAIYDENQELLVPERQLDYDILVMALGSKSNDFGTPGIKEHCIFLDSPQQAHRFHNEMLNLFLKYSADSNAEAENRKVNIAIVGGGATGVELSAELHNAVRQLNSYGLKKLAPSALNITLVEAGERILPALPVRISSAAHQELTKLGVRVMTKTMVTSADEKGLNTKDGEHIDADLMVWAAGIKAPDFMKDIAGLETNRINQLVVKPTLQTTLDDAIFAIGDCASCPRKEGGFVPPRAQSAHQMASRCYSNILAMLKGKTLKEYVFKDHGSLVSLSKFSTVGSLMGNLMKGDMMIEGRIARIVYISLYRMHQIALHGYLKTGLMMLVGSINRVIRPKLKLH

Flanking regions ( +/- flanking 50bp)

ACCAAGATGACTTAAATAACAACAGTAAATATCTTTAGGAGTGACGTTATATGTCATTAACAAAAATTGTTATAGTCGGTGGTGGAGCTGGTGGATTAGAACTAGCGACTAAATTGGGTGATAAGTTAGGGCGCAAAAAAAAAGCAGAAATTACCCTTGTTGATAGAAATAATAGTCACTTATGGAAACCTCTGTTACATGAAGTTGCCACAGGCTCGTTAGATGATGGTGTTGATGCATTAAGTTATCTCGCTCATGGTTATAACCATCACTTTAATTTTCAATTAGGCACTTTAACAGGGCTTGATCGCCAACATAAAAATATCACTTTGGCTGCTATTTATGATGAAAATCAAGAGCTATTAGTTCCAGAGCGTCAACTCGATTATGATATTTTAGTCATGGCCTTAGGCAGTAAATCTAATGATTTTGGCACCCCAGGGATCAAAGAGCACTGCATCTTTTTAGATAGCCCACAGCAAGCACACCGTTTTCATAATGAAATGCTCAATTTATTTTTAAAATATTCAGCAGACTCCAACGCAGAAGCTGAAAATCGTAAAGTAAATATTGCGATTGTGGGTGGTGGTGCAACTGGAGTGGAATTATCTGCCGAATTACACAATGCTGTTCGCCAACTCAATAGTTATGGTTTAAAAAAATTAGCGCCATCAGCCCTTAATATCACGCTTGTTGAGGCGGGTGAGCGAATATTACCTGCATTACCCGTGCGTATTTCAAGTGCAGCACATCAAGAGCTGACTAAGTTGGGTGTGCGCGTGATGACGAAAACCATGGTAACAAGCGCCGATGAAAAAGGGTTAAATACCAAAGATGGCGAGCATATTGATGCTGATCTGATGGTTTGGGCTGCGGGGATCAAAGCCCCAGACTTTATGAAAGATATCGCTGGATTAGAAACCAATCGTATTAACCAATTAGTCGTTAAGCCGACATTACAAACAACATTAGATGATGCGATTTTTGCGATTGGTGATTGTGCATCCTGTCCGCGAAAAGAGGGAGGTTTTGTTCCGCCAAGGGCACAATCCGCTCATCAAATGGCAAGCCGTTGTTATAGCAATATTTTAGCCATGTTAAAGGGTAAAACGTTAAAAGAATATGTGTTTAAAGATCATGGCTCGTTAGTTTCGCTCTCTAAATTTAGTACGGTAGGGAGTTTGATGGGCAACTTAATGAAAGGCGATATGATGATAGAAGGGCGTATTGCACGTATCGTTTATATTTCTTTATACCGTATGCACCAAATCGCGTTACATGGTTATCTTAAAACGGGTTTGATGATGTTAGTTGGATCAATCAATCGTGTGATTAGACCAAAACTAAAACTTCATTAGTGAATAATGGTTTATTTTTCTAACTTTTGTTTCTTTTAGCAAACAAAAGT