Homologs in group_1952

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14650 FBDBKF_14650 95.4 Morganella morganii S1 ndh NADH dehydrogenase, FAD-containing subunit
EHELCC_15455 EHELCC_15455 95.4 Morganella morganii S2 ndh NADH dehydrogenase, FAD-containing subunit
NLDBIP_15985 NLDBIP_15985 95.4 Morganella morganii S4 ndh NADH dehydrogenase, FAD-containing subunit
LHKJJB_15855 LHKJJB_15855 95.4 Morganella morganii S3 ndh NADH dehydrogenase, FAD-containing subunit
HKOGLL_14975 HKOGLL_14975 95.4 Morganella morganii S5 ndh NADH dehydrogenase, FAD-containing subunit
PMI_RS04295 PMI_RS04295 83.3 Proteus mirabilis HI4320 - NAD(P)/FAD-dependent oxidoreductase

Distribution of the homologs in the orthogroup group_1952

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1952

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P00393 0.0 710 79 0 434 1 ndh Type II NADH:quinone oxidoreductase Escherichia coli (strain K12)
P44856 1.2e-168 483 54 1 430 3 ndh Type II NADH:quinone oxidoreductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6GIE7 3.31e-43 159 28 10 391 3 SAR0903 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain MRSA252)
Q7A6J4 3.31e-43 159 28 10 391 1 SA0802 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain N315)
Q99VE0 3.31e-43 159 28 10 391 3 None Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHE4 3.31e-43 159 28 10 391 3 SACOL0944 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain COL)
Q2FZV7 3.31e-43 159 28 10 391 1 SAOUHSC_00878 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FID4 3.31e-43 159 28 10 391 3 SAUSA300_0844 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300)
Q2YWP9 3.41e-43 159 28 10 391 3 SAB0807 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q49W80 1.54e-42 157 29 12 394 3 SSP1834 Type II NADH:quinone oxidoreductase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8NXG0 3.08e-42 156 28 10 391 3 MW0823 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain MW2)
Q6GAY5 3.08e-42 156 28 10 391 3 SAS0811 Type II NADH:quinone oxidoreductase Staphylococcus aureus (strain MSSA476)
Q4L4V6 1.18e-37 144 28 12 393 3 SH2010 Type II NADH:quinone oxidoreductase Staphylococcus haemolyticus (strain JCSC1435)
P80861 5.77e-37 142 31 7 373 1 yjlD NADH dehydrogenase-like protein YjlD Bacillus subtilis (strain 168)
Q8CPV5 6.61e-37 142 26 10 394 3 SE_0635 Type II NADH:quinone oxidoreductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P95200 1.73e-36 142 28 14 440 1 ndhA Type II NADH:quinone oxidoreductase NdhA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q5HQM1 2.92e-36 140 26 10 394 3 SERP0527 Type II NADH:quinone oxidoreductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P95160 7.28e-34 135 27 11 428 1 ndh Type II NADH:quinone oxidoreductase Ndh Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P73735 7.34e-34 134 28 12 433 1 ndbB Demethylphylloquinone reductase NdbB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O05267 2.16e-29 121 28 12 392 3 yumB NADH dehydrogenase-like protein YumB Bacillus subtilis (strain 168)
Q55CD9 7.73e-28 118 26 8 403 3 DDB_G0270104 Probable NADH dehydrogenase Dictyostelium discoideum
O32117 6.18e-27 114 25 12 403 3 yutJ NADH dehydrogenase-like protein YutJ Bacillus subtilis (strain 168)
M1BYJ7 1.13e-25 112 26 11 334 3 NDB1 External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial Solanum tuberosum
Q9ST62 1.45e-24 109 27 11 329 1 NDB1 External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial Solanum tuberosum
O43090 1.99e-24 108 26 9 361 3 SPBC947.15c Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1JPL4 2.32e-23 105 25 10 333 1 NDB1 External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial Arabidopsis thaliana
Q8GXR9 3.95e-22 102 27 12 391 1 NDC1 Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial Arabidopsis thaliana
F4JJJ3 5.24e-21 99 26 14 385 2 NDB3 External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial Arabidopsis thaliana
O14121 2.13e-20 97 26 10 350 3 SPAC3A11.07 Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q94BV7 1.51e-19 94 29 15 344 1 NDB2 External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial Arabidopsis thaliana
Q9SKT7 1.03e-18 92 26 11 331 1 NDB4 External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial Arabidopsis thaliana
P40215 2.1e-16 85 28 14 357 1 NDE1 External NADH-ubiquinone oxidoreductase 1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
F2Z699 4.1e-16 84 26 13 357 1 NDH2 External alternative NADH-ubiquinone oxidoreductase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
O80874 5.84e-16 83 23 11 423 1 NDA2 Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial Arabidopsis thaliana
Q8GWA1 1.18e-15 82 24 15 428 2 NDA1 Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial Arabidopsis thaliana
Q54NS8 6.28e-15 79 27 16 346 3 aifB Apoptosis-inducing factor homolog B Dictyostelium discoideum
P32340 2.93e-14 78 24 15 448 1 NDI1 Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q07500 1.32e-12 73 25 12 347 1 NDE2 External NADH-ubiquinone oxidoreductase 2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
M0ZYF3 8.16e-12 70 23 13 424 3 NDA1 Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial Solanum tuberosum
Q9ST63 9.84e-12 70 23 13 424 1 NDA1 Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial Solanum tuberosum
A6TCX6 1.56e-10 66 27 16 351 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q0VTB0 1.18e-09 63 27 17 341 1 rubB Rubredoxin-NAD(+) reductase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B5XVA0 1.44e-09 63 26 14 348 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Klebsiella pneumoniae (strain 342)
A0A142C7A5 1.13e-08 60 24 17 429 1 phnG Oxidoreductase phnG Penicillium herquei
A0A067XMP1 3.61e-08 58 25 15 379 2 ptaL Oxidoreductase ptaL Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
P37596 5.35e-08 58 24 15 357 1 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12)
B1IUW8 5.35e-08 58 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XCN8 5.35e-08 58 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12 / DH10B)
C4ZYV6 5.35e-08 58 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain K12 / MC4100 / BW2952)
B1LQ29 6.86e-08 57 24 15 360 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain SMS-3-5 / SECEC)
Q58065 8.84e-08 57 23 14 314 3 MJ0649 NADH oxidase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A8A3I8 9.89e-08 57 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O9:H4 (strain HS)
Q32CL7 1.33e-07 57 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella dysenteriae serotype 1 (strain Sd197)
B7UHC3 1.41e-07 57 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7M9E8 1.42e-07 57 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O8 (strain IAI1)
B7LEC2 1.42e-07 57 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain 55989 / EAEC)
Q8D4F7 1.45e-07 57 24 13 339 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Vibrio vulnificus (strain CMCP6)
Q0TEG9 1.64e-07 56 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5FXE5 1.71e-07 56 22 15 385 2 AIFM2 Ferroptosis suppressor protein 1 Taeniopygia guttata
Q8U1K9 2.13e-07 56 22 17 377 1 PF1197 NAD(P)H:rubredoxin oxidoreductase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
B5Z372 2.32e-07 56 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X850 2.32e-07 56 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O157:H7
Q1R7Y9 2.47e-07 56 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain UTI89 / UPEC)
A1AEQ1 2.47e-07 56 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O1:K1 / APEC
B7MKI0 2.47e-07 56 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7MYL1 2.63e-07 56 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O81 (strain ED1a)
B6I697 3.47e-07 55 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli (strain SE11)
B2U036 5.56e-07 55 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q31X75 6.64e-07 54 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella boydii serotype 4 (strain Sb227)
B7NSJ1 8.29e-07 54 23 15 360 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LW23 1.03e-06 54 24 15 358 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P59403 2.77e-06 52 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella flexneri
Q0T1D6 2.77e-06 52 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Shigella flexneri serotype 5b (strain 8401)
Q8FEN4 2.97e-06 52 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A653 3.13e-06 52 26 11 282 2 fer8 Fe-regulated protein 8 Ustilago maydis (strain 521 / FGSC 9021)
Q7MFY7 4.45e-06 52 24 12 339 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Vibrio vulnificus (strain YJ016)
A8GG95 4.5e-06 52 26 16 345 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Serratia proteamaculans (strain 568)
B7N6U1 5.94e-06 52 24 15 356 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B4TT18 1.03e-05 51 24 16 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella schwarzengrund (strain CVM19633)
B5F365 1.04e-05 51 24 15 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella agona (strain SL483)
B5FSZ2 1.07e-05 51 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella dublin (strain CT_02021853)
B4T3B2 1.11e-05 50 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella newport (strain SL254)
A9N0E0 1.21e-05 50 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5FG80 1.26e-05 50 26 9 236 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aliivibrio fischeri (strain MJ11)
P43494 2.02e-05 50 25 15 324 1 thcD Rhodocoxin reductase Rhodococcus erythropolis
Q8ZMJ6 2.18e-05 50 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A8ANR8 2.7e-05 49 23 16 359 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5RDG6 2.77e-05 49 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV90 3.98e-05 49 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella enteritidis PT4 (strain P125109)
P16640 6.08e-05 48 23 14 333 1 camA Putidaredoxin reductase CamA Pseudomonas putida
Q06458 6.77e-05 49 33 5 117 3 nasB Nitrite reductase [NAD(P)H] large subunit Klebsiella oxytoca
Q54NS9 9.79e-05 48 23 13 333 3 aifA Apoptosis-inducing factor homolog A Dictyostelium discoideum
Q8Z4C4 0.000151 47 25 18 360 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella typhi
B4TF25 0.000256 46 25 16 343 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella heidelberg (strain SL476)
Q10499 0.000266 47 24 12 326 3 aif1 Apoptosis-inducing factor 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
W8X9R5 0.000284 46 25 13 330 1 ctmF Probable ferredoxin reductase CtmF Castellaniella defragrans (strain DSM 12143 / CCUG 39792 / 65Phen)
C0PWN3 0.00045 45 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi C (strain RKS4594)
Q57KT2 0.00045 45 25 17 357 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella choleraesuis (strain SC-B67)
Q5E3X0 0.000551 45 27 6 171 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9HTK9 0.000564 45 25 14 324 1 alkT Rubredoxin-NAD(+) reductase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B5BEP9 0.000582 45 25 17 360 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi A (strain AKU_12601)
Q5PF36 0.000582 45 25 17 360 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P42454 0.000615 45 22 12 339 1 rubB Rubredoxin-NAD(+) reductase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A9MFX5 0.000719 45 23 13 340 3 norW Nitric oxide reductase FlRd-NAD(+) reductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07445
Feature type CDS
Gene -
Product NAD(P)/FAD-dependent oxidoreductase
Location 1558005 - 1559309 (strand: -1)
Length 1305 (nucleotides) / 434 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1952
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07992 Pyridine nucleotide-disulphide oxidoreductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1252 Energy production and conversion (C) C NADH dehydrogenase, FAD-containing subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03885 NADH:quinone reductase (non-electrogenic) [EC:1.6.5.9] Oxidative phosphorylation
Metabolic pathways		 -

Protein Sequence

MTTPNTKIVIIGGGAGGLELATQLGRKLGKKKKAEITLVDRNSSHLWKPLLHEVATGSLDDGVDALSYLAHARNHYFNFQLGAMTGLDRDSKKVTLAEIRDNSGELLVPERDLDYDILVMALGSTSNDFGTPGIRDNCIFLDSPTQAKRFHNEMLNLFLKYSASHGEGDKVNIAIVGGGATGVELSAELYNAVEQLHSYGFKGLNTDALNVTLVEAGERILPALPPKIAGAAHQELSKLGVRVMTQTMVTSADESGLNTKEGEHITASLMVWAAGIKAPDFLKDIGGLETNRINQLVVKPTLQTTVDDAVFAIGDCSSCPKKEGGFVPPRAQSAHQMATRCYHNILAVLSNKPLKEYVFKDHGSLVSLSRFSTVGSLMGNLMRGNMMIEGRIARIMYISLYRMHQIALHGYIKTGLMMLVGGINRIIRPRLKLH

Flanking regions ( +/- flanking 50bp)

TTTTTCGGGAAAGCCGTAAGATAACGTTAGATTATTTTTCAGAGGATGTTATGACTACACCTAATACGAAAATTGTGATTATCGGCGGTGGCGCGGGCGGCCTGGAACTGGCAACACAGCTCGGCCGTAAACTCGGTAAGAAGAAAAAAGCGGAAATCACCTTAGTCGATCGCAACAGCAGCCATTTATGGAAACCTCTTCTGCATGAGGTCGCGACCGGCTCTCTGGACGATGGCGTGGATGCTCTGAGTTATCTGGCGCATGCCCGTAACCATTATTTTAATTTCCAGCTGGGTGCAATGACAGGTCTTGATCGTGACAGTAAAAAGGTAACCCTGGCAGAAATCCGTGATAACAGCGGTGAACTGCTTGTGCCTGAGCGCGACCTGGACTATGACATCCTCGTGATGGCGCTGGGAAGCACCTCAAACGATTTTGGCACGCCGGGTATCAGGGATAACTGTATTTTCCTGGACAGCCCGACACAGGCGAAACGCTTCCATAATGAGATGCTGAATCTGTTCCTGAAGTATTCTGCCAGCCACGGCGAGGGCGATAAAGTGAATATCGCTATTGTCGGTGGCGGGGCAACGGGCGTTGAGTTATCGGCAGAGCTGTACAATGCCGTTGAGCAATTGCACAGCTACGGATTTAAAGGTCTGAATACCGATGCACTGAATGTGACGCTGGTGGAAGCCGGTGAGCGCATTCTGCCCGCACTGCCGCCTAAAATCGCAGGTGCCGCGCATCAGGAACTGAGCAAGCTGGGTGTCCGTGTGATGACTCAGACGATGGTTACCAGTGCGGATGAGTCCGGGCTGAATACCAAAGAGGGTGAGCACATCACCGCAAGTCTGATGGTCTGGGCTGCCGGTATTAAAGCACCTGATTTCCTGAAAGACATCGGCGGACTGGAAACTAACCGCATCAATCAGTTAGTTGTGAAACCGACATTACAGACAACGGTTGATGACGCTGTTTTTGCCATCGGTGACTGCTCATCCTGCCCGAAAAAAGAGGGTGGTTTTGTACCGCCGCGCGCTCAGTCTGCCCATCAGATGGCGACCCGCTGCTATCACAATATCCTCGCGGTACTCAGCAATAAGCCGCTGAAGGAGTATGTGTTTAAAGATCACGGTTCGCTGGTATCGCTCTCCCGCTTCAGTACTGTCGGCAGCCTGATGGGTAACCTGATGCGGGGTAATATGATGATTGAGGGGCGCATTGCCCGAATTATGTATATTTCACTGTATCGTATGCATCAGATAGCGTTACACGGCTATATTAAAACCGGGCTGATGATGTTGGTCGGGGGAATAAACCGGATTATCCGTCCGAGACTTAAATTACATTAATGTTAATGATGTAAAAAATAACGCCTGCGGGCGTTATTTTTTATCCCCCG