Homologs in group_384

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14720 FBDBKF_14720 80.3 Morganella morganii S1 fabD ACP S-malonyltransferase
EHELCC_15525 EHELCC_15525 80.3 Morganella morganii S2 fabD ACP S-malonyltransferase
NLDBIP_16055 NLDBIP_16055 80.3 Morganella morganii S4 fabD ACP S-malonyltransferase
LHKJJB_15785 LHKJJB_15785 80.3 Morganella morganii S3 fabD ACP S-malonyltransferase
HKOGLL_14905 HKOGLL_14905 80.3 Morganella morganii S5 fabD ACP S-malonyltransferase
F4V73_RS07515 F4V73_RS07515 77.7 Morganella psychrotolerans fabD ACP S-malonyltransferase
PMI_RS14345 PMI_RS14345 30.4 Proteus mirabilis HI4320 - ACP S-malonyltransferase

Distribution of the homologs in the orthogroup group_384

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_384

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O85140 1.73e-160 452 74 0 307 1 fabD Malonyl CoA-acyl carrier protein transacylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43712 1.06e-156 443 73 1 306 3 fabD Malonyl CoA-acyl carrier protein transacylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAI9 2.34e-156 442 73 0 307 1 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli (strain K12)
P0AAJ0 2.34e-156 442 73 0 307 3 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X8I7 1.05e-155 440 72 0 307 3 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli O157:H7
P71019 8.7e-88 268 44 2 308 3 fabD Malonyl CoA-acyl carrier protein transacylase Bacillus subtilis (strain 168)
Q8K9J6 6.63e-83 255 42 2 288 3 fabD Malonyl CoA-acyl carrier protein transacylase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q6GHK5 9.59e-73 229 36 2 311 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MRSA252)
Q93QD4 1.56e-72 229 36 2 311 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus
Q5HGK3 1.56e-72 229 36 2 311 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain COL)
Q7A124 3.56e-72 228 36 2 311 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MW2)
Q7A5Z3 3.56e-72 228 36 2 311 1 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain N315)
Q99UN8 3.56e-72 228 36 2 311 1 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6G9Y3 4.51e-72 228 36 2 311 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MSSA476)
Q89AH0 1.81e-66 213 35 2 308 3 fabD Malonyl CoA-acyl carrier protein transacylase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9R9J2 3.28e-59 197 35 2 305 1 fenF Malonyl CoA-acyl carrier protein transacylase Bacillus subtilis
O34825 3.71e-52 176 36 5 289 1 pksC Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC Bacillus subtilis (strain 168)
P73242 6.83e-52 175 37 6 301 1 fabD Malonyl CoA-acyl carrier protein transacylase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A7Z4X8 1.05e-51 174 37 7 295 1 baeC Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A7Z4Y0 4.38e-51 182 37 6 288 1 baeE Polyketide biosynthesis protein BaeE Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O34787 1.08e-46 171 36 5 286 1 pksE Polyketide biosynthesis protein PksE Bacillus subtilis (strain 168)
Q8IVS2 6.59e-44 157 33 6 316 1 MCAT Malonyl-CoA-acyl carrier protein transacylase, mitochondrial Homo sapiens
Q2T4N0 3.1e-43 161 34 5 286 3 thaF Polyketide biosynthesis protein ThaF Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N0 0.000404 45 25 13 308 3 thaF Polyketide biosynthesis protein ThaF Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8T3L6 1.8e-39 145 33 5 311 2 beg Probable malonyl-CoA-acyl carrier protein transacylase, mitochondrial Drosophila melanogaster
Q8R3F5 3.7e-39 144 33 6 304 1 Mcat Malonyl-CoA-acyl carrier protein transacylase, mitochondrial Mus musculus
E9F8M3 6.06e-33 132 33 10 289 1 swnK PKS-NRPS hybrid synthetase swnK Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
D4AU31 2.72e-31 127 30 8 312 3 swnK PKS-NRPS hybrid synthetase swnK Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
I6XD69 5.53e-29 120 33 8 305 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I6XD69 2.81e-14 77 29 10 289 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B2HIL7 2.81e-28 118 33 7 285 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium marinum (strain ATCC BAA-535 / M)
G3XNF4 6.59e-27 114 32 10 291 1 ATPKS PKS-NRPS hybrid synthetase ATPKS Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A0A2I2F262 2.27e-26 112 29 8 291 1 acdB PKS-NRPS hybrid synthetase acdB Aspergillus candidus
P9WNG5 6.28e-26 107 33 7 305 1 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNG4 6.28e-26 107 33 7 305 3 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63459 6.28e-26 107 33 7 305 3 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P96285 3.64e-25 109 31 6 288 1 pks1 Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXK8 4.32e-25 109 31 6 288 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A1B3PEI6 6.65e-24 105 27 7 311 1 ORF-A Polyunsaturated fatty acid synthase subunit A Thraustochytrium sp. (strain ATCC 26185 / S-3)
Q9ZGI5 1.21e-23 105 33 10 290 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 3.03e-16 83 29 10 284 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 7.45e-16 82 29 9 284 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
P9WQE1 1.49e-23 104 28 8 292 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE0 1.49e-23 104 28 8 292 3 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TXL6 1.57e-23 104 28 8 292 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q03131 2.88e-23 103 30 11 285 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 2.76e-12 71 26 10 320 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 3.53e-07 55 28 11 299 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
O13698 3.45e-22 97 28 11 309 3 mct1 Malonyl CoA-acyl carrier protein transacylase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0A455LXK0 3.08e-20 94 27 10 319 2 ntnG Non-reducing polyketide synthase ntnG Nectria sp.
P0CU67 3.18e-20 94 29 9 299 1 claG Atrochrysone carboxylic acid synthase Passalora fulva
P9WQE3 2.17e-19 92 32 11 283 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit D Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE2 2.17e-19 92 32 11 283 3 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TXL7 2.54e-19 92 32 11 283 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9ZGI3 5.81e-19 90 30 9 283 1 pikAIII Narbonolide/10-deoxymethynolide synthase PikA3, module 5 Streptomyces venezuelae
A0A455M7S4 1.34e-18 90 26 7 291 1 atnG Non-reducing polyketide synthase atnG Arthrinium sp.
Q07017 4.36e-18 88 31 9 282 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
Q07017 3.16e-17 85 30 6 280 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
W3X7U2 4.85e-18 88 29 11 297 2 PfmaE Conidial pigment polyketide synthase PfmaE Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
B8MV60 8.99e-18 87 27 9 292 3 tpeB Non-reducing polyketide synthase tpeB Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
B8MYS6 9.08e-18 87 28 10 286 1 pks27 Non-reducing polyketide synthase pks27 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0R0B2 1.59e-17 84 30 6 257 1 fabD Malonyl CoA-acyl carrier protein transacylase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9ZGI2 1.97e-17 86 28 10 284 1 pikAIV Narbonolide/10-deoxymethynolide synthase PikA4, module 6 Streptomyces venezuelae
Q9ZGI4 3.42e-17 85 29 10 288 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q9ZGI4 6.28e-14 76 28 8 286 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q03149 5.65e-17 85 28 11 295 1 wA Conidial yellow pigment biosynthesis polyketide synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A1L9WLD9 6.77e-17 84 28 10 301 1 AacuL Atrochrysone carboxylic acid synthase AacuL Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A6F9DYX9 9.69e-17 84 30 6 224 1 men2 Non-reducing polyketide synthase men2 Menisporopsis theobromae
D7PHZ2 1.3e-16 84 26 9 302 1 vrtA Non-reducing polyketide synthase vrtA Penicillium aethiopicum
D4AWH3 1.71e-16 83 29 10 297 3 nscA Non-reducing polyketide synthase nscA Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
J4UHQ6 1.86e-16 83 32 12 257 1 OpS1 Orsellinic acid synthase Beauveria bassiana (strain ARSEF 2860)
A1D8I9 2.01e-16 83 27 8 300 3 nscA Non-reducing polyketide synthase nscA Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q5B0D0 2.28e-16 83 24 6 299 1 aptA Non-reducing polyketide synthase aptA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
F2S6Z9 2.8e-16 83 29 11 309 3 nscA Non-reducing polyketide synthase nscA Trichophyton tonsurans (strain CBS 112818)
P9WES9 3.16e-16 82 24 8 279 1 PFUR17_0229 Non-reducing polyketide synthase PFUR17_0229 Pseudevernia furfuracea
M1WG96 4.1e-16 82 26 10 302 2 CPUR_05437 Non-reducing polyketide synthase CPUR_05437 Claviceps purpurea (strain 20.1)
A0A6H0YV38 5.31e-16 82 25 8 299 2 crz7 Non-reducing polyketide synthase crz7 Cladonia metacorallifera
L7XAV2 6.15e-16 82 28 8 291 1 curS2 Non-reducing polyketide synthase curS2 Aspergillus terreus
A0A4P8DJU2 7.4e-16 81 26 8 306 3 dmx-nrPKS Atrochrysone carboxylic acid synthase Cryptosporiopsis sp. (strain 8999)
P9WET1 1.43e-15 80 28 12 313 1 Preu7 Non-reducing polyketide synthase Preu7 Preussia isomera
A0A098D6U0 1.44e-15 80 27 10 297 1 ZEA1 Non-reducing polyketide synthase ZEA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q03132 1.5e-15 80 26 8 283 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
Q03132 3.17e-12 70 26 8 280 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
E9KMQ2 1.55e-15 80 25 8 299 2 PKS16 Non-reducing polyketide synthase PKS16 Cladonia grayi
A7UMW1 1.6e-15 80 27 8 295 2 PKS1 Non-reducing polyketide synthase 1 Elsinoe fawcettii
B0G0Z9 2.52e-15 80 26 12 318 3 pks6 Probable polyketide synthase 6 Dictyostelium discoideum
E4V2N2 2.65e-15 80 29 10 300 3 nscA Non-reducing polyketide synthase nscA Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
A0A1W7M1U5 2.86e-15 80 28 11 298 1 pgmA Non-reducing polyketide synthase pgmA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
F2T0M0 2.94e-15 80 27 9 303 3 nscA Non-reducing polyketide synthase nscA Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q12397 3.52e-15 79 27 13 312 2 stcA Norsolorinic acid synthase stcA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
I1RLA7 3.71e-15 79 26 11 313 2 FGR1 Highly reducing polyketide synthase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q5AXA9 4.82e-15 79 28 5 246 1 pkgA Non-reducing polyketide synthase pkgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
S0DTP6 7.26e-15 79 26 9 292 2 FSR1 Non-reducing polyketide synthase fsr1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q4WA61 7.74e-15 78 27 9 300 3 nscA Non-reducing polyketide synthase nscA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4W944 8.17e-15 78 27 9 294 1 encA Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q86AE3 9.71e-15 78 25 10 317 2 pks9 Probable polyketide synthase 9/36 Dictyostelium discoideum
A0A0N0DCA3 1.03e-14 78 28 12 326 2 DEP5 Reducing polyketide synthase DEP5 Fusarium langsethiae
Q4WQZ5 1.13e-14 78 27 9 301 2 tpcC Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A7Z4X9 1.13e-14 76 25 9 290 1 baeD Polyketide biosynthesis acyltransferase homolog BaeD Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5BA83 1.21e-14 78 26 10 308 3 easB Highly reducing polyketide synthase easB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0B4G9F9 1.36e-14 78 27 11 296 1 Pks1 Polyketide synthase 1 Metarhizium guizhouense (strain ARSEF 977)
A0A1W5T1T1 1.39e-14 78 27 12 309 2 poxF Highly reducing polyketide synthase poxF Penicillium oxalicum
B0G101 1.67e-14 77 25 10 317 3 pks8 Probable polyketide synthase 8/35 Dictyostelium discoideum
M3A326 1.72e-14 77 26 9 300 2 PKS8-1 Non-reducing polyketide synthase PKS8-1 Pseudocercospora fijiensis (strain CIRAD86)
Q55DM7 2.05e-14 77 24 11 317 3 pks2 Probable polyketide synthase 2 Dictyostelium discoideum
B3FWS8 2.42e-14 77 27 8 293 1 hpm3 Non-reducing polyketide synthase hmp3 Hypomyces subiculosus
Q5AUX1 2.59e-14 77 27 9 302 1 orsA Orsellinic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
S0DRI1 2.7e-14 77 27 15 316 1 FUB1 Reducing polyketide synthase FUB1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P9WET9 3.83e-14 76 30 8 238 1 PvBS090_009107 Non-reducing polyketide synthase PvBS090_009107 Byssochlamys spectabilis
Q3S2U6 4.43e-14 76 28 14 327 1 mokB Lovastatin diketide synthase mokB Monascus pilosus
A0A0S6XH49 5.19e-14 76 27 9 300 1 frbB Highly reducing polyketide synthase frbB Fungal sp. (strain No.11243)
A0A084API3 6.91e-14 75 28 14 307 3 SAT13 Highly reducing polyketide synthase SAT13 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
Q5BH30 7.01e-14 75 26 9 297 3 mdpG Atrochrysone carboxylic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0B4H4F0 7.02e-14 75 27 13 311 1 Pks1 Polyketide synthase 1 Metarhizium majus (strain ARSEF 297)
A0A0B4FTU6 7.63e-14 75 26 12 305 1 Pks1 Polyketide synthase 1 Metarhizium anisopliae (strain ARSEF 549)
W7LKX1 7.91e-14 75 29 16 326 2 FUM1 Highly reducing polyketide synthase FUM1 Gibberella moniliformis (strain M3125 / FGSC 7600)
B6QK76 8.21e-14 75 25 10 298 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN5 8.21e-14 75 25 10 298 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei
Q0CCY3 1.15e-13 75 25 9 299 1 gedC Atrochrysone carboxylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
E9EHG2 1.28e-13 75 27 12 312 2 Pks2 Polyketide synthase 2 Metarhizium acridum (strain CQMa 102)
Q0D1N9 1.31e-13 75 25 7 294 1 terA Non-reducing polyketide synthase terA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q54B49 1.33e-13 75 23 12 312 3 pks45 Probable polyketide synthase 45 Dictyostelium discoideum
P9WET3 1.36e-13 75 27 8 300 1 Preu8 Non-reducing polyketide synthase Preu8 Preussia isomera
D4CZZ2 1.6e-13 74 27 10 306 3 nscA Non-reducing polyketide synthase nscA Trichophyton verrucosum (strain HKI 0517)
A0A1B5L6A0 1.76e-13 74 26 11 297 1 UVI_02036160 Non-reducing polyketide synthase ustP Ustilaginoidea virens
O53901 2.04e-13 74 28 9 308 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A0A2KT65 2.36e-13 74 26 9 299 2 melA Conidial yellow pigment biosynthesis polyketide synthase melA Penicillium expansum
C5H882 2.81e-13 73 26 11 310 3 radS2 Non-reducing polyketide synthase rads2 Floropilus chiversii
B3FWT6 2.96e-13 73 26 11 297 1 rdc1 Non-reducing polyketide synthase rdc1 Metacordyceps chlamydosporia
Q54FD2 3.37e-13 73 25 8 265 3 pks38 Probable polyketide synthase 38 Dictyostelium discoideum
E9F646 3.81e-13 73 27 12 307 1 Pks1 Polyketide synthase 1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A2U8NEV6 3.84e-13 73 26 11 297 1 Pks1 Polyketide synthase 1 Metarhizium acridum (strain CQMa 102)
B0G100 4.64e-13 73 25 10 317 3 pks7 Probable polyketide synthase 7 Dictyostelium discoideum
Q03133 4.69e-13 73 27 7 282 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q03133 1.75e-12 71 28 10 297 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
A0A0B4ESU9 5.49e-13 73 26 11 303 1 Pks1 Polyketide synthase 1 Metarhizium brunneum (strain ARSEF 3297)
W7MT31 5.76e-13 73 27 11 249 1 FUB1 Reducing polyketide synthase FUB1 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A067XNI2 6.15e-13 73 27 12 302 2 ptaA Non-reducing polyketide synthase ptaA Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
A0A411PQP9 6.47e-13 72 26 8 302 3 Agnpks1 Atrochrysone carboxylic acid synthase Agnpks1 Paecilomyces divaricatus
Q54FN2 7.67e-13 72 25 8 267 3 pks34 Probable polyketide synthase 34 Dictyostelium discoideum
F2PWS5 8.04e-13 72 28 10 305 3 nscA Non-reducing polyketide synthase nscA Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
C5FM57 8.35e-13 72 27 8 298 3 nscA Non-reducing polyketide synthase nscA Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
B6HNK3 8.68e-13 72 25 12 312 3 sorA Highly reducing polyketide synthase sorA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
M2XHZ5 8.78e-13 72 26 9 306 2 pksA Norsolorinic acid synthase Dothistroma septosporum (strain NZE10 / CBS 128990)
Q30DW5 8.78e-13 72 26 9 306 2 pksA Norsolorinic acid synthase Dothistroma septosporum
A0A3G9K3K9 1.15e-12 72 32 6 193 1 hisps Hispidin synthase Neonothopanus nambi
A0A0B4I1L1 1.41e-12 72 28 12 314 2 Pks2 Polyketide synthase 2 Metarhizium guizhouense (strain ARSEF 977)
A0A0D2YG10 1.44e-12 72 27 11 249 1 FUB1 Reducing polyketide synthase FUB1 Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936)
A0A3G9GQ29 2.91e-12 70 27 11 300 1 cdmE 6-hydroxymellein synthase cdmE Talaromyces verruculosus
Q4WZA8 3.02e-12 70 27 8 249 1 alb1 Conidial pigment polyketide synthase alb1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A0B4I1J8 4.27e-12 70 28 11 314 2 Pks2 Polyketide synthase 2 Metarhizium majus (strain ARSEF 297)
A0A0N7D745 4.33e-12 70 24 7 294 2 Dhc5 Non-reducing polyketide synthase Dhc5 Alternaria cinerariae
Q54ED6 5.5e-12 70 22 11 330 3 pks41 Probable polyketide synthase 41 Dictyostelium discoideum
R4WH05 5.54e-12 70 29 16 337 3 ACRTS2 Highly reducing polyketide synthase ACRTS2 Alternaria alternata
W3X8X8 5.95e-12 70 25 9 287 1 fnsA Naringenin synthase Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
A0A481WQB6 6.03e-12 70 25 9 294 1 claF Clavatol synthase claF Penicillium crustosum
Q54FC8 7.62e-12 69 25 8 265 3 pks39 Probable polyketide synthase 39 Dictyostelium discoideum
I1RF58 7.63e-12 69 26 9 308 1 PKS12 Non-reducing polyketide synthase PKS12 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q5AUX7 7.87e-12 69 26 6 238 1 dbaI Non-reducing polyketide synthase dbaI Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A4P8GHJ1 7.96e-12 69 23 11 302 1 eupA 3-methylorcinaldehyde synthase Phoma sp.
Q12053 8.53e-12 69 24 7 291 1 aflC Norsolorinic acid synthase Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
P9WEV0 8.75e-12 69 29 8 225 3 valA Highly reducing polyketide synthase valA Aspergillus terreus
A0R1E8 1.06e-11 69 26 9 293 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q54FN7 1.22e-11 69 26 10 267 3 pks33 Probable polyketide synthase 33 Dictyostelium discoideum
Q54ED7 1.24e-11 68 22 10 331 3 pks40 Probable polyketide synthase 40 Dictyostelium discoideum
A0A0B4FLB2 1.27e-11 68 28 11 312 2 Pks2 Polyketide synthase 2 Metarhizium anisopliae (strain ARSEF 549)
I1RVD8 1.29e-11 68 24 7 288 3 PKS6 Highly reducing polyketide synthase PKS6 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
B8MV59 1.32e-11 68 26 10 307 3 tpeA Partially reducing polyketide synthase tpeA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
E9ET39 1.32e-11 68 28 11 312 2 Pks2 Polyketide synthase 2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
F9XMW3 1.4e-11 68 25 7 295 3 PKS1 Non-reducing polyketide synthase PKS1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
A0A2I1C3X5 1.46e-11 68 25 12 307 1 nsrB Atrochrysone carboxylic acid synthase nsrB Aspergillus novofumigatus (strain IBT 16806)
O34877 1.54e-11 67 22 10 292 1 pksD Polyketide biosynthesis acyltransferase homolog PksD Bacillus subtilis (strain 168)
Q54FQ2 1.95e-11 68 25 11 276 3 pks30 Probable polyketide synthase 30 Dictyostelium discoideum
A0A0B4H8J1 2.07e-11 68 27 10 312 2 Pks2 Polyketide synthase 2 Metarhizium brunneum (strain ARSEF 3297)
A2QX22 2.5e-11 68 26 9 300 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q7TXL9 2.66e-11 68 27 9 285 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
G3XMC4 2.67e-11 68 23 10 318 1 azaA Non-reducing polyketide synthase azaA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
P9WQE5 2.68e-11 68 27 9 285 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE4 2.68e-11 68 27 9 285 3 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q0CF73 2.7e-11 68 26 10 296 1 ATEG_07661 Non-reducing polyketide synthase ATEG_07661 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q54FQ1 2.72e-11 68 25 8 267 3 pks31 Probable polyketide synthase 31 Dictyostelium discoideum
I3ZNU9 3.39e-11 67 25 5 238 1 armB Orsellinic acid synthase armB Armillaria mellea
A0A1P8NTI3 3.84e-11 67 25 8 302 2 pks8 Non-reducing polyketide synthase 8 Pestalotiopsis microspora
A2R6H1 4.09e-11 67 28 15 308 2 otaA Highly reducing polyketide synthase otaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A2QTE9 4.4e-11 67 23 10 318 3 epaA Non-reducing polyketide synthase epaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q0CRQ5 4.44e-11 67 27 6 223 1 ATEG_03629 5-methylorsellinic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A2I2F2N6 4.46e-11 67 28 11 290 1 cfoA Chalcone synthase cfoA Aspergillus candidus
Q0C8M3 5.06e-11 67 27 7 223 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q5BEJ6 5.12e-11 67 25 9 299 1 afoE Iterative polyketide synthase afoE Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A142C799 5.29e-11 67 29 8 234 1 phnA Non-reducing polyketide synthase phnA Penicillium herquei
Q55CN6 5.32e-11 67 27 6 190 3 pks3 Probable polyketide synthase 3 Dictyostelium discoideum
Q54FQ3 5.4e-11 67 25 8 269 3 pks29 Probable polyketide synthase 29 Dictyostelium discoideum
D2E9X0 5.48e-11 67 25 11 328 2 DEP5 Reducing polyketide synthase DEP5 Alternaria brassicicola
Q9Y8A5 5.96e-11 67 26 11 293 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus
Q54FP8 6.02e-11 67 25 11 276 3 pks32 Probable polyketide synthase 32 Dictyostelium discoideum
G3KLH6 6.15e-11 67 25 11 306 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger
A0A5C1RD96 6.17e-11 67 23 8 294 3 pksAC Non-reducing polyketide synthase AC Didymella fabae
P0DUT7 6.77e-11 67 27 14 309 1 Ba17a Highly reducing polyketide synthase 17 Metarhizium anisopliae
Q0CSA2 7.05e-11 67 27 4 198 1 tazA Non-reducing polyketide synthase tazA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A1R3RGK0 7.65e-11 66 28 15 303 1 otaA Highly reducing polyketide synthase otaA Aspergillus carbonarius (strain ITEM 5010)
P9WQE7 7.77e-11 66 27 9 285 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
N4WHA7 9.37e-11 66 27 15 317 3 PKS2 Reducing polyketide synthase PKS2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q54FI3 1.04e-10 66 29 7 175 1 StlB Polyketide synthase 37 Dictyostelium discoideum
A0A443HK81 1.05e-10 66 24 11 292 1 VdtA Non-reducing polyketide synthase VdtA Byssochlamys spectabilis
A0A0H4ADX3 1.1e-10 66 27 8 268 2 None Non-reducing polyketide synthase PKS19 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A084B9Z6 1.12e-10 66 27 13 295 3 SAT8 Non-reducing polyketide synthase SAT8 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
Q0UI00 1.26e-10 65 24 8 297 1 elcA Non-reducing polyketide synthase elcA (Fragment) Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A1B4XBH3 1.33e-10 65 27 13 314 3 sdnO Highly reducing polyketide synthase sdnO Sordaria araneosa
A0A0N9HNS9 1.4e-10 65 26 8 266 3 desS Desertorin synthase Aspergillus desertorum
A0A6S5ZY48 1.4e-10 65 26 14 331 2 g433 Highly reducing polyketide synthase g433 Fusarium sp.
A0A284RE13 1.44e-10 65 25 6 241 1 armB Orsellinic acid synthase ArmB Armillaria ostoyae
A0A1L9UCG2 1.54e-10 65 25 10 298 3 albA Non-reducing polyketide synthase albA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
C8VJR7 1.58e-10 65 26 12 321 1 alnA Highly reducing polyketide synthase alnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
W6QDA2 1.64e-10 65 30 6 185 1 anuA Highly reducing polyketide synthase anuA Penicillium roqueforti (strain FM164)
P9WET5 1.71e-10 65 27 6 233 1 Preu4 Non-reducing polyketide synthase Preu4 Preussia isomera
B8M9J9 1.74e-10 65 21 6 249 1 tropA 3-methylorcinaldehyde synthase tropA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0A2U8NET4 2.03e-10 65 26 7 229 1 Pks1 Polyketide synthase 1 Metarhizium album (strain ARSEF 1941)
P9WET4 2.08e-10 65 28 14 279 1 Preu5 Highly reducing polyketide synthase Preu5 Preussia isomera
Q86JI5 2.51e-10 65 23 10 317 2 pks5 Probable polyketide synthase 5 Dictyostelium discoideum
P9WQE9 2.66e-10 65 25 7 291 1 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE8 2.66e-10 65 25 7 291 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9F4 2.66e-10 65 25 7 291 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q7TVK8 2.66e-10 65 25 7 291 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A2H3CTK0 2.87e-10 65 26 6 241 1 armB Orsellinic acid synthase armB Armillaria gallica
Q54B51 2.97e-10 65 25 7 230 3 pks44 Probable polyketide synthase 44 Dictyostelium discoideum
A0A348HAX6 3.02e-10 65 25 14 317 1 phiA Highly reducing polyketide synthase phiA Fungal sp. (strain ATCC 74256)
Q54QD1 3.06e-10 64 23 10 271 3 pks23 Probable polyketide synthase 23 Dictyostelium discoideum
A1KQG0 3.52e-10 64 25 7 284 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P9WQE6 4.16e-10 64 27 9 285 3 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q54QD3 4.28e-10 64 23 11 272 3 pks22 Probable polyketide synthase 22 Dictyostelium discoideum
Q8J0F7 4.89e-10 64 30 10 229 1 mlcA Compactin nonaketide synthase, polyketide synthase component Penicillium citrinum
A0A2V5GX43 4.96e-10 64 26 14 320 3 pyvA Hybrid PKS-NRPS synthetase pyvA Aspergillus violaceofuscus (strain CBS 115571)
Q7TXM0 5.13e-10 64 27 11 289 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A5PHD6 6.2e-10 63 25 8 237 1 aspks1 3-methylorcinaldehyde synthase Sarocladium schorii
A0A0K0MCJ4 6.91e-10 63 28 10 247 1 cazM Iterative polyketide synthase CazM Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
B8MKY6 1.15e-09 63 23 12 334 1 tstA Highly reducing polyketide synthase tstA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A0A7R7ZK98 1.2e-09 63 25 10 307 3 AcPKS Atrochrysone carboxylic acid synthase Aspergillus chevalieri
S0EMV0 1.31e-09 62 26 12 307 1 GPY1 Highly reducing polyketide synthase GPY1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q6DQW3 1.34e-09 62 25 9 294 1 CTB1 Non-reducing polyketide synthase CTB1 Cercospora nicotianae
Q5KTM9 1.81e-09 62 31 10 226 1 alt5 Highly reducing polyketide synthase alt5 Alternaria solani
A0A2G5IC96 2.16e-09 62 25 9 294 3 CTB1 Non-reducing polyketide synthase CTB1 Cercospora beticola
Q5ATG8 2.29e-09 62 26 9 296 1 apdA Hybrid PKS-NRPS synthetase apdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54G30 2.47e-09 62 25 7 266 3 pks27 Probable polyketide synthase 27 Dictyostelium discoideum
Q02251 2.69e-09 62 28 6 209 1 mas Mycocerosic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A2QUI2 2.9e-09 62 24 8 297 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
G3XLL5 3e-09 62 24 8 297 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
P9WET2 3.27e-09 61 23 12 313 1 Preu6 Non-reducing polyketide synthase Preu6 Preussia isomera
A0A161CEU9 3.28e-09 61 24 9 308 1 citS Citrinin polyketide synthase Monascus ruber
Q65Z23 3.28e-09 61 24 9 308 1 pksCT Citrinin polyketide synthase Monascus purpureus
Q5B7U4 3.68e-09 61 25 10 296 1 pkiA Non-reducing polyketide synthase pkiA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q559A9 4.07e-09 61 22 6 261 3 pks13 Probable polyketide synthase 13 Dictyostelium discoideum
G1XU04 4.7e-09 61 26 7 265 1 AOL_s00215g283 6-methylsalicylic acid synthase AOL_s00215g283 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)
B0G138 4.82e-09 61 26 5 187 3 pks21 Probable polyketide synthase 21 Dictyostelium discoideum
Q54T36 5.18e-09 61 26 5 187 3 pks19 Probable polyketide synthase 19 Dictyostelium discoideum
Q5BBP8 6.79e-09 60 26 10 297 1 pkhA Non-reducing polyketide synthase pkhA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A8F4SKJ7 6.86e-09 60 23 8 289 1 atr1 Non-reducing polyketide synthase atr1 Stereocaulon alpinum
A0A7L9EYL1 6.87e-09 60 26 12 336 1 xenE Hybrid PKS-NRPS synthetase xenE Xenoacremonium sinensis
G4NEB1 7.1e-09 60 23 12 347 1 NEC1 Highly reducing polyketide synthase NEC1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
E5A7D9 7.65e-09 60 25 11 279 2 pks5 Highly reducing polyketide synthase pks5 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
A0A068ABB7 7.74e-09 60 23 10 309 1 Bref-PKS Highly reducing polyketide synthase Eupenicillium brefeldianum
A0A1L9WQM9 9.89e-09 60 26 14 321 2 acrA Highly reducing polyketide synthase acrA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
G3XMD1 1.21e-08 60 28 7 232 1 azaB Highly reducing polyketide synthase azaB Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q2UB00 1.26e-08 60 25 13 304 3 ppsB Reducing polyketide synthase ppsB Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A0A3G1DJH7 1.31e-08 59 25 12 312 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
A5ABG0 1.44e-08 59 26 13 319 1 pynA Hybrid PKS-NRPS synthetase pynA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
P9WET7 1.57e-08 59 25 12 342 2 Preu2 Reducing polyketide synthase Preu2 Preussia isomera
Q0CF75 1.65e-08 59 27 9 227 1 ATEG_07659 Highly reducing polyketide synthase ATEG_07659 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
S0EEY3 2.08e-08 59 25 14 334 1 FUS1 Fusarin C synthetase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
G0R6S8 2.21e-08 59 23 11 310 2 sor1 Highly reducing polyketide synthase sor1 Hypocrea jecorina (strain QM6a)
A0A098D8A0 2.34e-08 58 25 11 311 2 ZEA2 Highly reducing polyketide synthase ZEA2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P9WET8 2.54e-08 58 26 12 324 2 Preu1 Highly reducing polyketide synthase Preu1 Preussia isomera
S3D9F1 2.69e-08 58 25 11 310 1 gloL Highly reducing polyketide synthase gloL Glarea lozoyensis (strain ATCC 20868 / MF5171)
A0A097ZPE0 2.76e-08 58 26 6 226 1 andM Non-reducing polyketide synthase andM Emericella variicolor
C5H885 3.1e-08 58 26 15 314 3 rads1 Reducing polyketide synthase rads1 Floropilus chiversii
Q5B8A0 3.15e-08 58 26 7 240 1 pkfA Non-reducing polyketide synthase pkfA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
S0DZM7 3.25e-08 58 23 11 303 1 bik1 Bikaverin polyketide synthase bik1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q86ZD9 3.5e-08 58 24 13 310 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain C2932)
A2QK66 3.67e-08 58 24 8 302 3 ktnS Kotanin synthase Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q5BBP5 3.82e-08 58 26 11 273 1 pkhB Highly reducing polyketide synthase pkhB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B0G170 4.01e-08 58 27 4 176 3 pks28 Probable polyketide synthase 28 Dictyostelium discoideum
Q2HBN0 4.22e-08 58 28 8 228 1 cghG Hybrid PKS-NRPS synthetase cghG Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
E5AE40 4.41e-08 58 29 10 233 2 PKS2 Highly reducing polyketide synthase PKS2 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
S4W172 4.49e-08 58 27 10 245 1 eqxS Equisetin synthetase eqxS Fusarium heterosporum
Q55E72 4.68e-08 58 25 8 186 1 stlA Probable polyketide synthase 1 Dictyostelium discoideum
Q3S2T9 4.76e-08 58 28 11 237 1 mokA Lovastatin nonaketide synthase mokA Monascus pilosus
Q0C9L7 5.08e-08 58 26 11 303 1 ctvA Highly reducing polyketide synthase ctvA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q869W9 6.16e-08 57 26 6 175 2 pks16 Probable polyketide synthase 16 Dictyostelium discoideum
P9WES2 6.23e-08 57 28 4 192 1 None Atrochrysone carboxylic acid synthase PKS4 Calonarius odorifer
A0A4P8DJV2 6.46e-08 57 26 11 317 3 dmxL2 Highly reducing polyketide synthase dmxL2 Cryptosporiopsis sp. (strain 8999)
A0A6F9DXA0 6.74e-08 57 26 11 310 1 men1 Partially reducing polyketide synthase men1 Menisporopsis theobromae
A0A017SEX7 6.94e-08 57 28 6 187 1 fogA Highly reducing polyketide synthase fogA Aspergillus ruber (strain CBS 135680)
A0A3G9H990 7.37e-08 57 26 12 304 1 ALT1 Highly reducing polyketide synthase ALT1 Alternaria alternata
A0A384XH94 7.55e-08 57 23 14 340 1 stpks1 Highly reducing polyketide synthase stpks1 Strobilurus tenacellus
Q5BEJ4 7.69e-08 57 27 14 329 1 afoG Asperfuranone polyketide synthase afoG Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7SHI6 8.52e-08 57 27 16 312 2 srdA Highly reducing polyketide synthase srdA Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A0A0Y0M151 8.67e-08 57 25 15 327 1 cla2 Highly reducing polyketide synthase cla2 Cladosporium cladosporioides
A0A125R003 9.98e-08 57 24 11 325 1 cla3 Non-reducing polyketide synthase cla3 Cladosporium cladosporioides
B0G103 1.03e-07 57 25 4 176 3 pks10 Probable polyketide synthase 10 Dictyostelium discoideum
A0A193PS74 1.04e-07 57 23 9 299 1 stbA Non-reducing polyketide synthase stbA Stachybotrys bisbyi
P9WES1 1.06e-07 57 27 4 190 1 None Atrochrysone carboxylic acid synthase PKS1 Calonarius odorifer
W7MLD7 1.06e-07 57 24 12 332 1 FUS1 Fusarin C synthetase Gibberella moniliformis (strain M3125 / FGSC 7600)
B3FWT3 1.1e-07 57 26 12 307 1 hpm8 Reducing polyketide synthase hmp8 Hypomyces subiculosus
A0A481WR96 1.2e-07 57 24 10 318 3 claI Highly reducing polyketide synthase claI Penicillium crustosum
B3FWU0 1.31e-07 56 25 14 315 1 rdc5 Reducing polyketide synthase rdc5 Metacordyceps chlamydosporia
Q54KU3 1.36e-07 56 25 6 186 3 pks25 Probable polyketide synthase 25 Dictyostelium discoideum
B1GVX7 1.49e-07 56 27 12 300 2 BOA6 Reducing polyketide synthase BOA6 Botryotinia fuckeliana (strain B05.10)
Q0CJ59 1.57e-07 56 23 11 297 1 atX 6-methylsalicylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P0DUK1 1.74e-07 56 25 10 300 3 pspA Highly reducing polyketide synthase pspA Penicillium soppii
Q54KU5 1.81e-07 56 25 6 186 3 pks24 Probable polyketide synthase 24 Dictyostelium discoideum
P9WEZ4 2.41e-07 55 29 9 209 2 pytA Hybrid PKS-NRPS synthetase pytA Aspergillus terreus
A0A089QRB9 2.74e-07 55 26 9 311 1 msl3 Mycolipanoate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
L7X8J4 2.9e-07 55 25 14 316 1 curS1 Highly reducing polyketide synthase curS1 Aspergillus terreus
A0A0U4ZX08 3.06e-07 55 25 10 320 1 drtA Low-reducing polyketide synthase drtA Aspergillus calidoustus
I1S166 3.56e-07 55 25 12 338 2 FSL1 Fusarielin synthase FSL1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
B8N8R0 3.89e-07 55 27 2 136 2 afvB Non-reducing polyketide synthase afvB Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A2P1DP91 4.08e-07 55 25 10 284 1 macA 6-methylsalicylic acid synthase Penicillium terrestre
A0A084R1H6 4.31e-07 55 26 6 223 3 ATR6 Highly reducing polyketide synthase ATR6 Stachybotrys chlorohalonata (strain IBT 40285)
A0A482N9V7 4.52e-07 55 26 13 310 1 iccA Hybrid PKS-NRPS synthetase iccA Talaromyces variabilis
Q50LG3 4.61e-07 55 25 12 305 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
D7PI15 4.92e-07 55 24 8 270 1 gsfA Non-reducing polyketide synthase gsfA Penicillium aethiopicum
Q9Y7D5 5.55e-07 54 26 14 329 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus
P9WEQ0 6.32e-07 54 26 8 209 3 olcA Non-reducing polyketide synthase olcA Penicillium canescens
A0A8F4S8Q3 6.4e-07 54 26 5 221 1 gkaA Hybrid PKS-NRPS synthetase gkaA Penicillium citrinum
A0A1L7U3D7 6.62e-07 54 25 12 328 2 FPY1 Highly reducing polyketide synthase 40 Fusarium mangiferae
Q2ABP6 6.69e-07 54 25 14 337 1 pksF Reducing polyketide synthase pksF Alternaria solani
P0CU84 6.74e-07 54 26 12 305 1 apmlA Highly reducing polyketide synthase apmlA Arthrinium phaeospermum
Q0CZH1 7.07e-07 54 28 8 183 2 pytA Hybrid PKS-NRPS synthetase pytA (Fragment) Aspergillus terreus (strain NIH 2624 / FGSC A1156)
B6HN77 8.02e-07 54 25 8 238 3 sorB Non-reducing polyketide synthase sorB Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
G3Y419 8.94e-07 54 23 10 288 1 yanA 6-methylsalicylic acid synthase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q5ATJ7 9.12e-07 54 24 7 229 1 ausA Non-reducing polyketide synthase ausA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0E4AZP0 1.09e-06 53 28 9 216 3 fsa1 Hybrid PKS-NRPS synthetase fsa1 Fusarium sp. (strain FN080326)
I6X8D2 1.17e-06 53 26 7 250 1 pks13 Polyketide synthase Pks13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q5SBL6 1.2e-06 53 27 11 300 3 fsdS Fusaridione A synthetase fsdS Fusarium heterosporum
B4XYB8 1.3e-06 53 28 9 278 1 aziB 5-methyl-1-naphthoate synthase Streptomyces sahachiroi
P9WET6 1.35e-06 53 25 7 206 1 Preu3 Non-reducing polyketide synthase Preu3 Preussia isomera
G0R6S9 1.55e-06 53 23 6 229 2 sor2 Non-reducing polyketide synthase sor2 Hypocrea jecorina (strain QM6a)
Q0CS88 1.56e-06 53 26 7 197 2 tazB Highly reducing polyketide synthase tazB Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P96202 1.61e-06 53 26 12 302 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXL8 1.61e-06 53 26 12 302 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A3G1DJF3 1.65e-06 53 25 15 315 2 pks2 Squalestatin hexaketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
G4N296 1.72e-06 53 26 6 200 2 PKS19 Highly reducing polyketide synthase 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
S7Z800 1.91e-06 53 23 12 305 3 opdA Hybrid PKS-NRPs synthetase opdA Penicillium oxalicum (strain 114-2 / CGMCC 5302)
K2QVI8 2.05e-06 53 25 7 225 1 dpmpA Non-reducing polyketide synthase dpmpA Macrophomina phaseolina (strain MS6)
A1CFL8 2.11e-06 53 24 11 291 1 patK 6-methylcalicylic acide synthase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q869X2 2.31e-06 52 26 6 175 3 pks17 Probable polyketide synthase 17 Dictyostelium discoideum
Q54D44 2.58e-06 52 28 7 178 3 pks42 Probable polyketide synthase 42 Dictyostelium discoideum
A0A8D5M692 2.98e-06 52 27 2 143 1 esdpA Non-reducing polyketide synthase esdpA Penicillium shearii
A0A0U5GFS8 3.09e-06 52 25 7 211 1 ausA Non-reducing polyketide synthase ausA Aspergillus calidoustus
A0A0D1DNX1 3.31e-06 52 26 20 355 2 fas2 Fatty acid synthase 2 Ustilago maydis (strain 521 / FGSC 9021)
Q8J0F5 3.32e-06 52 24 12 319 1 mlcB Compactin diketide synthase mlcB Penicillium citrinum
A0A2Z5TM64 4e-06 52 25 10 329 3 himA Polyketide synthase-nonribosomal peptide synthetase hybrid himA Aspergillus japonicus
Q4WLD4 4.73e-06 52 32 3 131 1 pyr2 Non-reducing polyketide synthase pyr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A1L7U4V5 4.73e-06 52 26 9 238 2 FMN1 Reducing polyketide synthase 8 Fusarium mangiferae
E9F5E7 4.85e-06 52 25 8 228 1 subA Non-reducing polyketide synthase subA Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A0A2JW91 5.53e-06 51 24 9 315 1 cnsI Highly reducing polyketide synthase cnsI Penicillium expansum
P9WEX6 5.9e-06 51 25 8 228 1 dpmaA Non-reducing polyketide synthase dpmaA Metarhizium anisopliae
Q5BG07 6.28e-06 51 20 8 315 1 pkdA Non-reducing polyketide synthase pkdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
G3J453 7.86e-06 51 25 15 319 1 cm3B Highly reducing polyketide synthase cm3B Cordyceps militaris (strain CM01)
B8NJG3 8.27e-06 51 25 13 300 3 lepA Hybrid PKS-NRPS synthetase lepA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A1V6NYI6 1.01e-05 50 29 9 216 3 verA Highly reducing polyketide synthase verA Penicillium polonicum
N4WHE3 1.1e-05 50 25 11 299 3 PKS1 Reducing polyketide synthase PKS1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
A0A0N7D4P6 1.47e-05 50 24 13 318 2 Dhc3 Highly reducing polyketide synthase Dhc3 Alternaria cinerariae
P22367 1.66e-05 50 24 12 320 1 None 6-methylsalicylic acid synthase Penicillium patulum
A0A6J4B487 1.87e-05 50 26 7 222 3 LUC5 Hybrid PKS-NRPS synthetase LUC5 Fusarium sp.
A0A075TRC0 2.13e-05 49 24 10 318 1 patK 6-methylsalicylic acid synthase Penicillium expansum
P34731 2.36e-05 49 32 6 143 1 FAS1 Fatty acid synthase subunit beta Candida albicans
A0A167LUQ4 2.42e-05 49 26 14 317 3 fumoS Fumosorinone synthetase Cordyceps fumosorosea (strain ARSEF 2679)
A0A8F4S6Z6 2.81e-05 49 25 5 222 1 pydA Hybrid PKS-NRPS synthetase pydA Acremonium sp.
A0A3T0QHT6 3.23e-05 49 27 15 304 1 pvhA Hybrid PKS-NRPS synthetase pvhA Talaromyces variabilis
D9N1A1 3.44e-05 49 23 9 302 2 ACTTS3 Highly reducing polyketide synthase ACTTS3 Alternaria alternata
Q558W4 3.78e-05 49 22 7 236 3 pks15 Probable polyketide synthase 15 Dictyostelium discoideum
P34229 4.16e-05 48 31 6 190 3 FAS1 Fatty acid synthase subunit beta Yarrowia lipolytica (strain CLIB 122 / E 150)
A0A0R8YWJ7 4.23e-05 48 22 8 242 1 mpas Methylphloroacetophenone synthase Cladonia uncialis
J4KMC1 5.65e-05 48 26 13 345 1 tenS Tenellin synthetase Beauveria bassiana (strain ARSEF 2860)
A0A0M4L8I7 5.7e-05 48 24 12 299 1 aurA Highly reducing polyketide synthase aurA Calcarisporium arbuscula
K3VA96 5.71e-05 48 27 6 188 3 PKS40 Highly reducing polyketide synthase 40 Fusarium pseudograminearum (strain CS3096)
A0A1L9WN37 6.1e-05 48 23 10 280 1 acuA 6-methylsalicylic acid synthase acuA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q0D159 6.43e-05 48 26 7 226 2 ATEG_00325 Hybrid PKS-NRPS synthetase ATEG_00325 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q54TW0 6.94e-05 48 23 7 203 2 pks18 Probable polyketide synthase 18 Dictyostelium discoideum
V5Y0F7 8.9e-05 47 23 11 296 3 AFT16-1 Reducing polyketide synthase AFT16-1 Alternaria alternata
A0A0G0AID6 0.000134 47 24 9 301 1 thnA Hybrid PKS-NRPS synthetase thnA Trichoderma harzianum
A0A1B7YCC9 0.000159 47 25 7 243 1 dpchA Non-reducing polyketide synthase dpchA Colletotrichum higginsianum (strain IMI 349063)
A0A0S2CHA9 0.000164 47 21 7 238 1 pigA Non-reducing polyketide synthase pigA Monascus ruber
A0A179H2I8 0.00017 47 26 13 323 2 lcsB Highly reducing polyketide synthase lcsB Purpureocillium lilacinum
Q4WAZ9 0.000229 46 26 15 339 2 NRPS14 PKS-NRPS hybrid synthetase psoA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P07149 0.000254 46 29 7 183 1 FAS1 Fatty acid synthase subunit beta Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A179H0J7 0.000261 46 28 6 192 2 lcsC Highly reducing polyketide synthase lcsC Purpureocillium lilacinum
F1DBA9 0.000262 46 25 9 233 1 mpaC Non-reducing polyketide synthase mapC Penicillium brevicompactum
A0JJU1 0.000276 46 25 13 342 1 tenS Tenellin synthetase Beauveria bassiana
A0A455R5P9 0.000382 45 21 6 214 1 ascC Non-reducing polyketide synthase ascC Acremonium egyptiacum
G0REX6 0.000551 45 24 10 306 1 iliA Hybrid PKS-NRPS synthetase iliA Hypocrea jecorina (strain QM6a)
A0A089FSA4 0.000706 45 27 11 230 3 prlS Hybrid PKS-NRPS synthetase prlS Fungal sp. (strain NRRL 50135)
Q00706 0.000732 45 31 6 139 2 stcK Fatty acid synthase beta subunit stcK Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A2Z5XAL7 0.000856 45 25 7 224 1 phm1 Hybrid PKS-NRPS synthetase phm1 Pyrenochaetopsis sp.
P9WET0 0.001 44 24 13 322 1 Preu9 Polyketide synthase-like protein Preu9 Preussia isomera
Q84HC6 0.001 44 24 9 282 1 ncsB Neocarzinostatin naphthoate synthase Streptomyces carzinostaticus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04220
Feature type CDS
Gene fabD
Product ACP S-malonyltransferase
Location 950232 - 951164 (strand: 1)
Length 933 (nucleotides) / 310 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_384
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00698 Acyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0331 Lipid transport and metabolism (I) I Malonyl CoA-acyl carrier protein transacylase

Kegg Ortholog Annotation(s)

Protein Sequence

MTDFAMVFPGQGSQAIGMLAELAEHYPIVTETFAQASDVLGYSLWDLVQNGPEEELNKTWKTQPALLAASVAIWRVWQEKQGKMPQMMAGHSLGEYSALVCAGVIDFAAAIKLVELRGQLMQEAVPAGTGAMYAIIGLDNDAIAKACEDAAQGQVVSPVNFNSPGQVVIAGNKEAVERAGALCKEAGAKRALPLAVSVPSHCALMKPAADKLAVALQEIEFKQPEIQVVNNVDVKAQTDANAIRDALVRQLYNPVRWTETVEFIAGKGITQLLEIGPGKVLTGLTKRISKEMNAAAVNDIASLDAALGND

Flanking regions ( +/- flanking 50bp)

TACTTGGGGCTCTGCACTTATCCGTTTTTAATATTATCAGGAAAATAAACATGACTGATTTTGCAATGGTTTTCCCTGGACAGGGATCACAAGCGATTGGAATGCTTGCAGAACTTGCCGAGCATTATCCAATAGTGACAGAAACATTTGCTCAAGCATCTGATGTATTGGGTTATTCTCTTTGGGATTTAGTGCAAAATGGTCCTGAAGAAGAGTTAAACAAAACATGGAAAACACAGCCGGCATTATTAGCAGCATCCGTTGCTATTTGGCGAGTATGGCAAGAAAAACAAGGCAAAATGCCACAAATGATGGCAGGTCACAGTCTTGGTGAGTATTCTGCTTTAGTCTGTGCTGGCGTAATTGATTTTGCTGCGGCGATTAAACTAGTAGAATTGCGCGGTCAATTAATGCAAGAGGCTGTACCTGCAGGTACTGGCGCCATGTATGCAATTATCGGATTAGATAATGATGCTATTGCAAAAGCTTGTGAAGATGCGGCTCAAGGACAAGTTGTCTCACCTGTGAACTTTAACTCACCCGGTCAAGTGGTGATTGCGGGTAATAAAGAAGCCGTAGAGCGTGCAGGGGCATTATGTAAAGAAGCTGGAGCGAAACGTGCGTTACCTTTAGCGGTAAGTGTGCCTTCTCACTGTGCTTTAATGAAGCCTGCTGCAGATAAGTTAGCTGTTGCATTGCAAGAAATTGAATTTAAACAACCTGAAATTCAAGTTGTTAATAATGTTGATGTGAAAGCACAAACCGATGCTAATGCTATTCGAGATGCATTAGTTCGTCAGCTTTATAACCCAGTCCGCTGGACTGAAACGGTTGAATTTATTGCTGGTAAGGGCATCACACAATTATTAGAAATAGGACCCGGTAAAGTATTAACTGGTTTAACGAAACGTATTTCTAAAGAGATGAACGCTGCAGCAGTTAATGATATTGCATCATTAGACGCTGCATTAGGAAATGACTGAGGGATCTCATGGGATTTGACGGAAAAATAGCGCTAGTTACTGGTGCAAGC