Homologs in group_350

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14720 FBDBKF_14720 100.0 Morganella morganii S1 fabD ACP S-malonyltransferase
EHELCC_15525 EHELCC_15525 100.0 Morganella morganii S2 fabD ACP S-malonyltransferase
NLDBIP_16055 NLDBIP_16055 100.0 Morganella morganii S4 fabD ACP S-malonyltransferase
LHKJJB_15785 LHKJJB_15785 100.0 Morganella morganii S3 fabD ACP S-malonyltransferase
F4V73_RS07515 F4V73_RS07515 92.3 Morganella psychrotolerans fabD ACP S-malonyltransferase
PMI_RS04220 PMI_RS04220 80.3 Proteus mirabilis HI4320 fabD ACP S-malonyltransferase
PMI_RS14345 PMI_RS14345 30.1 Proteus mirabilis HI4320 - ACP S-malonyltransferase

Distribution of the homologs in the orthogroup group_350

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_350

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAI9 2.01e-168 472 77 0 308 1 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli (strain K12)
P0AAJ0 2.01e-168 472 77 0 308 3 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X8I7 1.35e-167 470 76 0 308 3 fabD Malonyl CoA-acyl carrier protein transacylase Escherichia coli O157:H7
O85140 2.66e-166 467 76 0 307 1 fabD Malonyl CoA-acyl carrier protein transacylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43712 2.85e-156 442 73 1 304 3 fabD Malonyl CoA-acyl carrier protein transacylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P71019 1.28e-84 260 44 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Bacillus subtilis (strain 168)
Q8K9J6 1.48e-82 254 42 2 288 3 fabD Malonyl CoA-acyl carrier protein transacylase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AH0 6.11e-73 230 35 2 309 3 fabD Malonyl CoA-acyl carrier protein transacylase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q6GHK5 7.45e-71 224 37 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MRSA252)
Q7A124 1.01e-70 224 37 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MW2)
Q7A5Z3 1.01e-70 224 37 2 310 1 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain N315)
Q99UN8 1.01e-70 224 37 2 310 1 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q93QD4 1.46e-70 224 37 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus
Q6G9Y3 1.46e-70 224 37 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain MSSA476)
Q5HGK3 1.46e-70 224 37 2 310 3 fabD Malonyl CoA-acyl carrier protein transacylase Staphylococcus aureus (strain COL)
Q9R9J2 1.1e-58 196 35 2 305 1 fenF Malonyl CoA-acyl carrier protein transacylase Bacillus subtilis
Q2T4N0 1.97e-47 174 37 5 291 3 thaF Polyketide biosynthesis protein ThaF Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N0 0.000155 47 25 12 294 3 thaF Polyketide biosynthesis protein ThaF Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
O34825 5.87e-47 162 36 6 285 1 pksC Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC Bacillus subtilis (strain 168)
P73242 1.42e-46 161 36 7 303 1 fabD Malonyl CoA-acyl carrier protein transacylase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A7Z4Y0 5.78e-45 166 35 7 286 1 baeE Polyketide biosynthesis protein BaeE Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A7Z4X8 9.59e-45 157 35 6 285 1 baeC Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8IVS2 2.24e-41 150 33 7 319 1 MCAT Malonyl-CoA-acyl carrier protein transacylase, mitochondrial Homo sapiens
O34787 2.62e-40 152 35 5 283 1 pksE Polyketide biosynthesis protein PksE Bacillus subtilis (strain 168)
Q8R3F5 1.28e-38 143 34 7 299 1 Mcat Malonyl-CoA-acyl carrier protein transacylase, mitochondrial Mus musculus
Q8T3L6 1.69e-38 142 34 8 308 2 beg Probable malonyl-CoA-acyl carrier protein transacylase, mitochondrial Drosophila melanogaster
E9F8M3 6.28e-35 137 34 9 290 1 swnK PKS-NRPS hybrid synthetase swnK Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
I6XD69 2.84e-30 124 34 10 309 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I6XD69 5.71e-15 79 32 15 290 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
D4AU31 5.48e-29 120 29 8 311 3 swnK PKS-NRPS hybrid synthetase swnK Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
A0A2I2F262 1.35e-26 113 29 8 294 1 acdB PKS-NRPS hybrid synthetase acdB Aspergillus candidus
G3XNF4 1.95e-26 113 32 10 291 1 ATPKS PKS-NRPS hybrid synthetase ATPKS Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q7TXL6 1.77e-24 107 30 8 296 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQE1 1.87e-24 107 30 8 296 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE0 1.87e-24 107 30 8 296 3 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WNG5 2.28e-24 103 32 6 303 1 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNG4 2.28e-24 103 32 6 303 3 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63459 2.28e-24 103 32 6 303 3 fabD Malonyl CoA-acyl carrier protein transacylase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A1B3PEI6 6.91e-24 105 26 8 335 1 ORF-A Polyunsaturated fatty acid synthase subunit A Thraustochytrium sp. (strain ATCC 26185 / S-3)
Q03131 4.84e-23 103 30 12 301 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 6.81e-16 82 28 9 296 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 6.89e-06 51 27 13 301 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
A0A455LXK0 5.69e-23 102 28 9 315 2 ntnG Non-reducing polyketide synthase ntnG Nectria sp.
Q7TXK8 1.39e-22 101 31 7 285 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A455M7S4 1.48e-22 101 28 8 314 1 atnG Non-reducing polyketide synthase atnG Arthrinium sp.
P96285 1.51e-22 101 31 7 285 1 pks1 Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9ZGI5 1.15e-21 99 33 9 291 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 1.02e-13 75 29 8 284 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 1.02e-13 75 27 9 326 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
B2HIL7 1.28e-21 99 31 8 285 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q07017 1.11e-20 96 33 9 298 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
Q07017 1.26e-19 93 33 10 298 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
A0R0B2 6e-20 91 31 10 260 1 fabD Malonyl CoA-acyl carrier protein transacylase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0A6F9DYX9 2.51e-19 92 29 8 296 1 men2 Non-reducing polyketide synthase men2 Menisporopsis theobromae
Q7TXL7 6.65e-19 90 32 13 289 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQE3 7.3e-19 90 32 13 289 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit D Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE2 7.3e-19 90 32 13 289 3 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O13698 4.46e-18 86 27 12 310 3 mct1 Malonyl CoA-acyl carrier protein transacylase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5BA83 3.14e-17 85 26 9 319 3 easB Highly reducing polyketide synthase easB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P0CU67 4.89e-17 85 26 9 308 1 claG Atrochrysone carboxylic acid synthase Passalora fulva
B3FWS8 5.72e-17 85 28 10 315 1 hpm3 Non-reducing polyketide synthase hmp3 Hypomyces subiculosus
Q9ZGI2 1.4e-16 84 28 9 284 1 pikAIV Narbonolide/10-deoxymethynolide synthase PikA4, module 6 Streptomyces venezuelae
Q9ZGI3 1.52e-16 84 29 11 286 1 pikAIII Narbonolide/10-deoxymethynolide synthase PikA3, module 5 Streptomyces venezuelae
E4V2N2 1.78e-16 83 28 12 307 3 nscA Non-reducing polyketide synthase nscA Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
D4AWH3 3.04e-16 82 28 13 313 3 nscA Non-reducing polyketide synthase nscA Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
L7XAV2 1.02e-15 81 26 10 319 1 curS2 Non-reducing polyketide synthase curS2 Aspergillus terreus
Q03133 1.98e-15 80 29 10 284 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q03133 3.9e-11 67 28 11 295 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q03149 2.11e-15 80 29 7 227 1 wA Conidial yellow pigment biosynthesis polyketide synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
F2T0M0 4.84e-15 79 26 10 306 3 nscA Non-reducing polyketide synthase nscA Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
P9WEV0 5.02e-15 79 28 12 319 3 valA Highly reducing polyketide synthase valA Aspergillus terreus
Q03132 5.06e-15 79 29 12 287 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
Q03132 8.04e-13 72 26 7 284 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
A0A6H0YV38 6.27e-15 79 26 9 299 2 crz7 Non-reducing polyketide synthase crz7 Cladonia metacorallifera
Q5BEJ6 7e-15 79 27 8 296 1 afoE Iterative polyketide synthase afoE Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
F2S6Z9 7.54e-15 79 26 10 306 3 nscA Non-reducing polyketide synthase nscA Trichophyton tonsurans (strain CBS 112818)
B8MYS6 8.17e-15 78 27 11 287 1 pks27 Non-reducing polyketide synthase pks27 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
P9WES9 8.35e-15 78 24 7 271 1 PFUR17_0229 Non-reducing polyketide synthase PFUR17_0229 Pseudevernia furfuracea
Q3S2U6 8.43e-15 78 28 15 328 1 mokB Lovastatin diketide synthase mokB Monascus pilosus
B8MV60 8.54e-15 78 27 12 301 3 tpeB Non-reducing polyketide synthase tpeB Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
A2QTE9 1.36e-14 78 23 9 311 3 epaA Non-reducing polyketide synthase epaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
E9KMQ2 1.81e-14 77 26 9 303 2 PKS16 Non-reducing polyketide synthase PKS16 Cladonia grayi
P9WET9 2.12e-14 77 29 10 277 1 PvBS090_009107 Non-reducing polyketide synthase PvBS090_009107 Byssochlamys spectabilis
Q0CCY3 2.43e-14 77 25 10 309 1 gedC Atrochrysone carboxylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A7Z4X9 2.6e-14 75 25 11 293 1 baeD Polyketide biosynthesis acyltransferase homolog BaeD Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A0A1L9WLD9 2.97e-14 77 30 7 235 1 AacuL Atrochrysone carboxylic acid synthase AacuL Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A067XNI2 3.28e-14 77 27 7 252 2 ptaA Non-reducing polyketide synthase ptaA Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
Q9ZGI4 3.42e-14 77 28 8 289 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q9ZGI4 2.09e-12 71 27 8 284 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q12397 3.44e-14 77 26 9 302 2 stcA Norsolorinic acid synthase stcA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0S6XH49 3.49e-14 77 27 8 303 1 frbB Highly reducing polyketide synthase frbB Fungal sp. (strain No.11243)
W3X7U2 4.44e-14 76 27 11 297 2 PfmaE Conidial pigment polyketide synthase PfmaE Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
D4CZZ2 4.59e-14 76 25 9 304 3 nscA Non-reducing polyketide synthase nscA Trichophyton verrucosum (strain HKI 0517)
G3XMC4 5.69e-14 76 24 12 314 1 azaA Non-reducing polyketide synthase azaA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
M1WG96 6.76e-14 75 24 9 301 2 CPUR_05437 Non-reducing polyketide synthase CPUR_05437 Claviceps purpurea (strain 20.1)
Q5AUX1 8.58e-14 75 26 8 315 1 orsA Orsellinic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C5H882 8.59e-14 75 26 9 314 3 radS2 Non-reducing polyketide synthase rads2 Floropilus chiversii
A1D8I9 9.57e-14 75 24 9 302 3 nscA Non-reducing polyketide synthase nscA Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
I1RVD8 9.68e-14 75 24 7 309 3 PKS6 Highly reducing polyketide synthase PKS6 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A098D6U0 9.81e-14 75 27 9 293 1 ZEA1 Non-reducing polyketide synthase ZEA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P9WET4 1.05e-13 75 26 14 336 1 Preu5 Highly reducing polyketide synthase Preu5 Preussia isomera
A0A0N7D745 1.33e-13 75 26 11 324 2 Dhc5 Non-reducing polyketide synthase Dhc5 Alternaria cinerariae
Q5AUX7 1.49e-13 75 27 8 252 1 dbaI Non-reducing polyketide synthase dbaI Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
W3X8X8 1.61e-13 74 26 9 286 1 fnsA Naringenin synthase Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
D7PHZ2 2.94e-13 73 24 9 294 1 vrtA Non-reducing polyketide synthase vrtA Penicillium aethiopicum
A0A1W5T1T1 3.94e-13 73 27 12 313 2 poxF Highly reducing polyketide synthase poxF Penicillium oxalicum
O53901 4.01e-13 73 29 11 307 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A3G9GQ29 4.1e-13 73 25 10 301 1 cdmE 6-hydroxymellein synthase cdmE Talaromyces verruculosus
A0A0A2KT65 4.53e-13 73 26 8 275 2 melA Conidial yellow pigment biosynthesis polyketide synthase melA Penicillium expansum
R4WH05 6.89e-13 72 28 15 337 3 ACRTS2 Highly reducing polyketide synthase ACRTS2 Alternaria alternata
Q5B8A0 7.66e-13 72 26 6 242 1 pkfA Non-reducing polyketide synthase pkfA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P9WQE5 7.95e-13 72 28 9 264 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE4 7.95e-13 72 28 9 264 3 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TXL9 8.1e-13 72 28 9 264 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A1W7M1U5 8.51e-13 72 26 10 295 1 pgmA Non-reducing polyketide synthase pgmA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
B0G0Z9 8.61e-13 72 23 11 319 3 pks6 Probable polyketide synthase 6 Dictyostelium discoideum
A0A0B4G9F9 9.01e-13 72 29 9 238 1 Pks1 Polyketide synthase 1 Metarhizium guizhouense (strain ARSEF 977)
P9WET1 9.34e-13 72 26 13 313 1 Preu7 Non-reducing polyketide synthase Preu7 Preussia isomera
A0A481WQB6 1.07e-12 72 26 9 294 1 claF Clavatol synthase claF Penicillium crustosum
Q54FD2 1.21e-12 72 27 10 268 3 pks38 Probable polyketide synthase 38 Dictyostelium discoideum
I3ZNU9 1.67e-12 71 26 4 234 1 armB Orsellinic acid synthase armB Armillaria mellea
A0A4P8DJU2 1.67e-12 71 24 8 300 3 dmx-nrPKS Atrochrysone carboxylic acid synthase Cryptosporiopsis sp. (strain 8999)
B0G101 1.71e-12 71 24 11 320 3 pks8 Probable polyketide synthase 8/35 Dictyostelium discoideum
A0A5C1RD96 1.74e-12 71 24 8 294 3 pksAC Non-reducing polyketide synthase AC Didymella fabae
Q0CF73 2.1e-12 71 26 10 297 1 ATEG_07661 Non-reducing polyketide synthase ATEG_07661 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A7UMW1 2.12e-12 71 26 8 296 2 PKS1 Non-reducing polyketide synthase 1 Elsinoe fawcettii
A0A4P8GHJ1 2.34e-12 71 23 11 302 1 eupA 3-methylorcinaldehyde synthase Phoma sp.
M3A326 2.59e-12 71 26 10 307 2 PKS8-1 Non-reducing polyketide synthase PKS8-1 Pseudocercospora fijiensis (strain CIRAD86)
J4UHQ6 2.66e-12 71 29 11 257 1 OpS1 Orsellinic acid synthase Beauveria bassiana (strain ARSEF 2860)
A0A084API3 2.71e-12 71 26 13 317 3 SAT13 Highly reducing polyketide synthase SAT13 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
M2XHZ5 2.94e-12 70 26 8 302 2 pksA Norsolorinic acid synthase Dothistroma septosporum (strain NZE10 / CBS 128990)
Q30DW5 2.94e-12 70 26 8 302 2 pksA Norsolorinic acid synthase Dothistroma septosporum
A0A443HK81 2.98e-12 70 23 11 323 1 VdtA Non-reducing polyketide synthase VdtA Byssochlamys spectabilis
A0A2I2F2N6 3.17e-12 70 28 9 287 1 cfoA Chalcone synthase cfoA Aspergillus candidus
P9WQE7 3.38e-12 70 28 9 264 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I1RF58 3.67e-12 70 24 6 266 1 PKS12 Non-reducing polyketide synthase PKS12 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q4WA61 3.68e-12 70 25 10 304 3 nscA Non-reducing polyketide synthase nscA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
F9XMW3 3.76e-12 70 26 9 301 3 PKS1 Non-reducing polyketide synthase PKS1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
A0A0B4I1L1 3.97e-12 70 29 11 276 2 Pks2 Polyketide synthase 2 Metarhizium guizhouense (strain ARSEF 977)
A0A084B9Z6 4.11e-12 70 27 11 295 3 SAT8 Non-reducing polyketide synthase SAT8 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
Q54ED7 4.14e-12 70 23 9 271 3 pks40 Probable polyketide synthase 40 Dictyostelium discoideum
A0A411PQP9 4.15e-12 70 26 10 297 3 Agnpks1 Atrochrysone carboxylic acid synthase Agnpks1 Paecilomyces divaricatus
Q5AXA9 4.56e-12 70 28 5 227 1 pkgA Non-reducing polyketide synthase pkgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B6QK76 4.8e-12 70 24 10 298 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN5 4.8e-12 70 24 10 298 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei
E9EHG2 5.28e-12 70 27 10 304 2 Pks2 Polyketide synthase 2 Metarhizium acridum (strain CQMa 102)
B8M9J9 5.47e-12 70 23 6 250 1 tropA 3-methylorcinaldehyde synthase tropA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q5BBP8 5.79e-12 70 27 8 242 1 pkhA Non-reducing polyketide synthase pkhA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
C8VJR7 5.9e-12 70 27 14 317 1 alnA Highly reducing polyketide synthase alnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A2U8NET4 6.38e-12 70 25 7 235 1 Pks1 Polyketide synthase 1 Metarhizium album (strain ARSEF 1941)
A0A0K0MCJ4 6.83e-12 70 28 8 243 1 cazM Iterative polyketide synthase CazM Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
S0DTP6 6.84e-12 69 25 12 298 2 FSR1 Non-reducing polyketide synthase fsr1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A0A0B4FTU6 7.32e-12 69 29 9 238 1 Pks1 Polyketide synthase 1 Metarhizium anisopliae (strain ARSEF 549)
A5PHD6 7.75e-12 69 27 7 210 1 aspks1 3-methylorcinaldehyde synthase Sarocladium schorii
Q4WQZ5 7.77e-12 69 26 10 311 2 tpcC Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A348HAX6 8.77e-12 69 24 12 316 1 phiA Highly reducing polyketide synthase phiA Fungal sp. (strain ATCC 74256)
B3FWT6 9.42e-12 69 26 12 301 1 rdc1 Non-reducing polyketide synthase rdc1 Metacordyceps chlamydosporia
Q86AE3 9.71e-12 69 23 10 320 2 pks9 Probable polyketide synthase 9/36 Dictyostelium discoideum
Q54B49 1.15e-11 69 25 8 236 3 pks45 Probable polyketide synthase 45 Dictyostelium discoideum
Q0D1N9 1.15e-11 69 24 7 294 1 terA Non-reducing polyketide synthase terA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A284RE13 1.23e-11 68 26 6 241 1 armB Orsellinic acid synthase ArmB Armillaria ostoyae
Q5AZ32 1.26e-11 68 26 9 291 1 pkbA Non-reducing polyketide synthase pkbA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B6HNK3 1.31e-11 68 26 13 293 3 sorA Highly reducing polyketide synthase sorA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
Q0UI00 1.46e-11 68 25 8 297 1 elcA Non-reducing polyketide synthase elcA (Fragment) Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A0B4H4F0 1.57e-11 68 28 9 238 1 Pks1 Polyketide synthase 1 Metarhizium majus (strain ARSEF 297)
O34877 1.69e-11 67 21 9 292 1 pksD Polyketide biosynthesis acyltransferase homolog PksD Bacillus subtilis (strain 168)
P9WQE6 1.95e-11 68 28 9 264 3 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5B0D0 1.95e-11 68 23 6 276 1 aptA Non-reducing polyketide synthase aptA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
F2PWS5 2.14e-11 68 25 9 302 3 nscA Non-reducing polyketide synthase nscA Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q4WZA8 2.17e-11 68 25 8 275 1 alb1 Conidial pigment polyketide synthase alb1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
E9F646 2.17e-11 68 28 9 238 1 Pks1 Polyketide synthase 1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A1B5L6A0 2.32e-11 68 26 10 302 1 UVI_02036160 Non-reducing polyketide synthase ustP Ustilaginoidea virens
S0EMV0 2.45e-11 68 28 15 311 1 GPY1 Highly reducing polyketide synthase GPY1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q7TXM0 2.68e-11 68 28 9 264 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
C5FM57 2.76e-11 68 26 11 319 3 nscA Non-reducing polyketide synthase nscA Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P0CU84 2.86e-11 68 27 11 310 1 apmlA Highly reducing polyketide synthase apmlA Arthrinium phaeospermum
Q55CN6 2.97e-11 68 24 9 266 3 pks3 Probable polyketide synthase 3 Dictyostelium discoideum
A0A0N0DCA3 3.23e-11 67 26 14 329 2 DEP5 Reducing polyketide synthase DEP5 Fusarium langsethiae
Q54ED6 3.28e-11 67 24 10 271 3 pks41 Probable polyketide synthase 41 Dictyostelium discoideum
Q5BH30 4.17e-11 67 25 7 268 3 mdpG Atrochrysone carboxylic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0B4ESU9 4.29e-11 67 28 9 238 1 Pks1 Polyketide synthase 1 Metarhizium brunneum (strain ARSEF 3297)
A0A2H3CTK0 4.42e-11 67 26 4 237 1 armB Orsellinic acid synthase armB Armillaria gallica
A0A142C799 4.45e-11 67 30 5 172 1 phnA Non-reducing polyketide synthase phnA Penicillium herquei
A0A0H4ADX3 4.67e-11 67 29 7 213 2 None Non-reducing polyketide synthase PKS19 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A0B4FLB2 5.19e-11 67 29 10 242 2 Pks2 Polyketide synthase 2 Metarhizium anisopliae (strain ARSEF 549)
E5A7D9 5.72e-11 67 26 10 274 2 pks5 Highly reducing polyketide synthase pks5 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
G0R6S8 6.05e-11 67 25 10 309 2 sor1 Highly reducing polyketide synthase sor1 Hypocrea jecorina (strain QM6a)
A0A2I1C3X5 6.27e-11 67 25 9 300 1 nsrB Atrochrysone carboxylic acid synthase nsrB Aspergillus novofumigatus (strain IBT 16806)
E5AE40 6.99e-11 67 27 14 321 2 PKS2 Highly reducing polyketide synthase PKS2 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
B0G100 7.17e-11 66 24 11 320 3 pks7 Probable polyketide synthase 7 Dictyostelium discoideum
A0A0B4I1J8 7.74e-11 66 28 10 284 2 Pks2 Polyketide synthase 2 Metarhizium majus (strain ARSEF 297)
A0A2U8NEV6 7.95e-11 66 27 8 237 1 Pks1 Polyketide synthase 1 Metarhizium acridum (strain CQMa 102)
B8MV59 8.76e-11 66 26 11 308 3 tpeA Partially reducing polyketide synthase tpeA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
W7LKX1 9.19e-11 66 28 15 313 2 FUM1 Highly reducing polyketide synthase FUM1 Gibberella moniliformis (strain M3125 / FGSC 7600)
Q0CSA2 9.35e-11 66 27 3 165 1 tazA Non-reducing polyketide synthase tazA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
G3XMD1 9.43e-11 66 29 8 233 1 azaB Highly reducing polyketide synthase azaB Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A5ABG0 9.62e-11 66 29 16 342 1 pynA Hybrid PKS-NRPS synthetase pynA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q4W944 9.77e-11 66 26 11 297 1 encA Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q54FC8 1.02e-10 66 24 8 265 3 pks39 Probable polyketide synthase 39 Dictyostelium discoideum
A0A0B4H8J1 1.03e-10 66 27 12 303 2 Pks2 Polyketide synthase 2 Metarhizium brunneum (strain ARSEF 3297)
Q02251 1.12e-10 66 28 6 209 1 mas Mycocerosic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8J0F7 1.23e-10 66 30 10 227 1 mlcA Compactin nonaketide synthase, polyketide synthase component Penicillium citrinum
Q54FN2 1.29e-10 65 23 7 265 3 pks34 Probable polyketide synthase 34 Dictyostelium discoideum
Q5B7U4 1.29e-10 65 26 11 296 1 pkiA Non-reducing polyketide synthase pkiA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
S3D9F1 1.33e-10 65 26 11 321 1 gloL Highly reducing polyketide synthase gloL Glarea lozoyensis (strain ATCC 20868 / MF5171)
P9WET3 1.71e-10 65 27 5 197 1 Preu8 Non-reducing polyketide synthase Preu8 Preussia isomera
B6HN77 1.97e-10 65 27 10 243 3 sorB Non-reducing polyketide synthase sorB Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
A0A1P8NTI3 2.1e-10 65 25 9 301 2 pks8 Non-reducing polyketide synthase 8 Pestalotiopsis microspora
E9ET39 2.24e-10 65 27 11 312 2 Pks2 Polyketide synthase 2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q55DM7 2.92e-10 65 23 6 209 3 pks2 Probable polyketide synthase 2 Dictyostelium discoideum
A0A3G9K3K9 3.02e-10 64 31 6 191 1 hisps Hispidin synthase Neonothopanus nambi
Q2UB00 3.06e-10 64 26 15 320 3 ppsB Reducing polyketide synthase ppsB Aspergillus oryzae (strain ATCC 42149 / RIB 40)
D7PI15 3.61e-10 64 26 9 273 1 gsfA Non-reducing polyketide synthase gsfA Penicillium aethiopicum
Q54FI3 3.62e-10 64 27 6 174 1 StlB Polyketide synthase 37 Dictyostelium discoideum
Q54FN7 3.63e-10 64 24 8 265 3 pks33 Probable polyketide synthase 33 Dictyostelium discoideum
A0A7R7ZK98 4.33e-10 64 24 11 322 3 AcPKS Atrochrysone carboxylic acid synthase Aspergillus chevalieri
Q54G30 4.55e-10 64 23 5 263 3 pks27 Probable polyketide synthase 27 Dictyostelium discoideum
Q54FQ1 5.69e-10 63 24 7 265 3 pks31 Probable polyketide synthase 31 Dictyostelium discoideum
A0R1E8 5.79e-10 63 25 7 290 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WQE9 5.95e-10 63 27 10 293 1 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE8 5.95e-10 63 27 10 293 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9F4 5.95e-10 63 27 10 293 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q7TVK8 5.95e-10 63 27 10 293 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0A097ZPE0 8.5e-10 63 25 10 296 1 andM Non-reducing polyketide synthase andM Emericella variicolor
Q6DQW3 9.65e-10 63 25 10 311 1 CTB1 Non-reducing polyketide synthase CTB1 Cercospora nicotianae
A1KQG0 9.7e-10 63 27 10 293 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q0CF75 1.01e-09 63 24 14 350 1 ATEG_07659 Highly reducing polyketide synthase ATEG_07659 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A3G1DJH7 1.08e-09 63 27 16 316 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
I1RLA7 1.09e-09 63 25 11 312 2 FGR1 Highly reducing polyketide synthase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P9WET2 1.13e-09 63 27 8 233 1 Preu6 Non-reducing polyketide synthase Preu6 Preussia isomera
G4NEB1 1.13e-09 63 25 14 344 1 NEC1 Highly reducing polyketide synthase NEC1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q86ZD9 1.48e-09 62 26 15 311 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain C2932)
Q0C9L7 1.54e-09 62 34 5 142 1 ctvA Highly reducing polyketide synthase ctvA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A2G5IC96 1.64e-09 62 25 10 311 3 CTB1 Non-reducing polyketide synthase CTB1 Cercospora beticola
Q54FP8 1.82e-09 62 27 5 176 3 pks32 Probable polyketide synthase 32 Dictyostelium discoideum
A0A0N9HNS9 2.2e-09 62 29 8 215 3 desS Desertorin synthase Aspergillus desertorum
B8MKY6 2.23e-09 62 26 8 209 1 tstA Highly reducing polyketide synthase tstA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
P9WET8 2.27e-09 62 25 12 331 2 Preu1 Highly reducing polyketide synthase Preu1 Preussia isomera
Q12053 2.33e-09 62 23 7 289 1 aflC Norsolorinic acid synthase Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
A0A161CEU9 2.44e-09 62 24 9 307 1 citS Citrinin polyketide synthase Monascus ruber
Q65Z23 2.44e-09 62 24 9 307 1 pksCT Citrinin polyketide synthase Monascus purpureus
W6QDA2 2.82e-09 62 30 6 183 1 anuA Highly reducing polyketide synthase anuA Penicillium roqueforti (strain FM164)
Q54FQ3 2.88e-09 62 27 5 176 3 pks29 Probable polyketide synthase 29 Dictyostelium discoideum
A0A2P1DP91 2.92e-09 62 26 10 299 1 macA 6-methylsalicylic acid synthase Penicillium terrestre
A0A1R3RGK0 2.94e-09 62 27 15 298 1 otaA Highly reducing polyketide synthase otaA Aspergillus carbonarius (strain ITEM 5010)
Q54B51 3.12e-09 61 25 7 235 3 pks44 Probable polyketide synthase 44 Dictyostelium discoideum
A0A1L9UCG2 3.23e-09 61 25 6 242 3 albA Non-reducing polyketide synthase albA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
A2QX22 3.59e-09 61 26 9 303 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A0A2V5GX43 4.29e-09 61 26 14 317 3 pyvA Hybrid PKS-NRPS synthetase pyvA Aspergillus violaceofuscus (strain CBS 115571)
P9WES2 4.31e-09 61 27 5 217 1 None Atrochrysone carboxylic acid synthase PKS4 Calonarius odorifer
Q54FQ2 4.48e-09 61 27 5 176 3 pks30 Probable polyketide synthase 30 Dictyostelium discoideum
Q86JI5 4.66e-09 61 22 12 320 2 pks5 Probable polyketide synthase 5 Dictyostelium discoideum
Q5BBP5 5.05e-09 61 25 11 278 1 pkhB Highly reducing polyketide synthase pkhB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
S0DZM7 5.28e-09 61 24 9 300 1 bik1 Bikaverin polyketide synthase bik1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P9WET5 5.55e-09 60 26 6 231 1 Preu4 Non-reducing polyketide synthase Preu4 Preussia isomera
B0G170 5.76e-09 60 23 5 263 3 pks28 Probable polyketide synthase 28 Dictyostelium discoideum
A0A6S5ZY48 6.61e-09 60 26 15 324 2 g433 Highly reducing polyketide synthase g433 Fusarium sp.
S0EEY3 6.74e-09 60 26 13 310 1 FUS1 Fusarin C synthetase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A0A6F9DXA0 7.06e-09 60 26 13 326 1 men1 Partially reducing polyketide synthase men1 Menisporopsis theobromae
A2R6H1 8.83e-09 60 25 14 308 2 otaA Highly reducing polyketide synthase otaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A0A481WR96 8.85e-09 60 25 10 320 3 claI Highly reducing polyketide synthase claI Penicillium crustosum
G3J453 9.57e-09 60 27 14 317 1 cm3B Highly reducing polyketide synthase cm3B Cordyceps militaris (strain CM01)
Q5KTM9 9.67e-09 60 29 10 241 1 alt5 Highly reducing polyketide synthase alt5 Alternaria solani
Q54T36 9.73e-09 60 22 9 315 3 pks19 Probable polyketide synthase 19 Dictyostelium discoideum
Q8TGA1 9.92e-09 60 34 6 140 2 aflB Fatty acid synthase beta subunit aflB Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
B0G138 1.01e-08 60 22 9 315 3 pks21 Probable polyketide synthase 21 Dictyostelium discoideum
P9WEQ0 1.15e-08 60 28 9 208 3 olcA Non-reducing polyketide synthase olcA Penicillium canescens
G3Y419 1.16e-08 60 24 12 301 1 yanA 6-methylsalicylic acid synthase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A1CFL8 1.33e-08 59 24 9 312 1 patK 6-methylcalicylic acide synthase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
G3KLH6 1.56e-08 59 25 9 303 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger
P9WET7 1.63e-08 59 25 12 336 2 Preu2 Reducing polyketide synthase Preu2 Preussia isomera
Q5BEJ4 1.64e-08 59 26 14 353 1 afoG Asperfuranone polyketide synthase afoG Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
L7X8J4 1.82e-08 59 25 15 344 1 curS1 Highly reducing polyketide synthase curS1 Aspergillus terreus
A0A3G9H990 2.06e-08 59 28 14 307 1 ALT1 Highly reducing polyketide synthase ALT1 Alternaria alternata
A2QUI2 2.16e-08 59 24 6 248 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
G3XLL5 2.38e-08 58 24 6 248 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
S4W172 2.44e-08 58 30 10 230 1 eqxS Equisetin synthetase eqxS Fusarium heterosporum
D2E9X0 2.83e-08 58 24 12 325 2 DEP5 Reducing polyketide synthase DEP5 Alternaria brassicicola
A0A084R1H6 2.88e-08 58 29 7 218 3 ATR6 Highly reducing polyketide synthase ATR6 Stachybotrys chlorohalonata (strain IBT 40285)
P9WET6 3e-08 58 23 9 293 1 Preu3 Non-reducing polyketide synthase Preu3 Preussia isomera
A0A1B4XBH3 3.1e-08 58 27 17 345 3 sdnO Highly reducing polyketide synthase sdnO Sordaria araneosa
P96202 3.15e-08 58 27 11 273 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXL8 3.15e-08 58 27 11 273 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WES1 3.48e-08 58 26 4 203 1 None Atrochrysone carboxylic acid synthase PKS1 Calonarius odorifer
W7MLD7 3.65e-08 58 27 14 310 1 FUS1 Fusarin C synthetase Gibberella moniliformis (strain M3125 / FGSC 7600)
Q0CRQ5 3.83e-08 58 25 6 215 1 ATEG_03629 5-methylorsellinic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
I1S166 4.19e-08 58 25 12 338 2 FSL1 Fusarielin synthase FSL1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A8F4SKJ7 4.29e-08 58 23 6 303 1 atr1 Non-reducing polyketide synthase atr1 Stereocaulon alpinum
A0A1L9WQM9 4.64e-08 58 28 9 217 2 acrA Highly reducing polyketide synthase acrA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
B1GVX7 4.73e-08 58 27 11 311 2 BOA6 Reducing polyketide synthase BOA6 Botryotinia fuckeliana (strain B05.10)
A0A7L9EYL1 4.79e-08 58 27 5 223 1 xenE Hybrid PKS-NRPS synthetase xenE Xenoacremonium sinensis
B8N8R0 4.83e-08 58 30 5 155 2 afvB Non-reducing polyketide synthase afvB Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
Q5ATG8 5.23e-08 58 25 10 304 1 apdA Hybrid PKS-NRPS synthetase apdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A068ABB7 5.54e-08 57 23 10 321 1 Bref-PKS Highly reducing polyketide synthase Eupenicillium brefeldianum
A0A0D1DNX1 6.07e-08 57 33 8 156 2 fas2 Fatty acid synthase 2 Ustilago maydis (strain 521 / FGSC 9021)
S0DRI1 6.88e-08 57 26 9 213 1 FUB1 Reducing polyketide synthase FUB1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q5BG07 8.94e-08 57 23 8 298 1 pkdA Non-reducing polyketide synthase pkdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q0C8M3 9.07e-08 57 26 7 222 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A0M4L8I7 9.27e-08 57 26 13 306 1 aurA Highly reducing polyketide synthase aurA Calcarisporium arbuscula
B3FWT3 9.31e-08 57 27 14 309 1 hpm8 Reducing polyketide synthase hmp8 Hypomyces subiculosus
A0A1L9WN37 1.12e-07 57 23 10 305 1 acuA 6-methylsalicylic acid synthase acuA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
G0R6S9 1.12e-07 57 24 8 237 2 sor2 Non-reducing polyketide synthase sor2 Hypocrea jecorina (strain QM6a)
Q5SBL6 1.13e-07 57 27 12 302 3 fsdS Fusaridione A synthetase fsdS Fusarium heterosporum
Q9Y8A5 1.31e-07 56 27 8 223 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus
Q3S2T9 1.81e-07 56 28 9 217 1 mokA Lovastatin nonaketide synthase mokA Monascus pilosus
A0A1L7U3D7 1.86e-07 56 25 11 330 2 FPY1 Highly reducing polyketide synthase 40 Fusarium mangiferae
F1DBA9 1.88e-07 56 24 8 247 1 mpaC Non-reducing polyketide synthase mapC Penicillium brevicompactum
G4N296 2.49e-07 55 27 5 191 2 PKS19 Highly reducing polyketide synthase 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q0CS88 2.77e-07 55 23 12 315 2 tazB Highly reducing polyketide synthase tazB Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A075TRC0 3.17e-07 55 25 10 316 1 patK 6-methylsalicylic acid synthase Penicillium expansum
A0A098D8A0 3.66e-07 55 25 15 341 2 ZEA2 Highly reducing polyketide synthase ZEA2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A0E4AZP0 3.68e-07 55 29 10 230 3 fsa1 Hybrid PKS-NRPS synthetase fsa1 Fusarium sp. (strain FN080326)
A0A2I1BSV9 3.88e-07 55 25 9 300 1 nvfA Non-reducing polyketide synthase nvfA Aspergillus novofumigatus (strain IBT 16806)
A0A0D2YG10 4.08e-07 55 25 9 223 1 FUB1 Reducing polyketide synthase FUB1 Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936)
A2QK66 5.15e-07 55 28 7 225 3 ktnS Kotanin synthase Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
W7MT31 5.29e-07 55 25 9 213 1 FUB1 Reducing polyketide synthase FUB1 Gibberella moniliformis (strain M3125 / FGSC 7600)
Q7SHI6 5.72e-07 54 26 12 299 2 srdA Highly reducing polyketide synthase srdA Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P9WEZ4 6.92e-07 54 26 13 310 2 pytA Hybrid PKS-NRPS synthetase pytA Aspergillus terreus
Q5ATJ7 7.3e-07 54 23 7 235 1 ausA Non-reducing polyketide synthase ausA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q559A9 7.58e-07 54 21 5 259 3 pks13 Probable polyketide synthase 13 Dictyostelium discoideum
D9N1A1 8.34e-07 54 24 11 314 2 ACTTS3 Highly reducing polyketide synthase ACTTS3 Alternaria alternata
A0A4P8DJV2 8.79e-07 54 24 6 240 3 dmxL2 Highly reducing polyketide synthase dmxL2 Cryptosporiopsis sp. (strain 8999)
A0A411KUP8 8.81e-07 54 26 10 332 1 ucsA Hybrid PKS-NRPS synthetase ucsA Acremonium sp.
A0A125R003 9.83e-07 53 25 8 232 1 cla3 Non-reducing polyketide synthase cla3 Cladosporium cladosporioides
B3FWU0 1.12e-06 53 28 10 214 1 rdc5 Reducing polyketide synthase rdc5 Metacordyceps chlamydosporia
B8NJG3 1.12e-06 53 25 13 307 3 lepA Hybrid PKS-NRPS synthetase lepA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
I6X8D2 1.22e-06 53 25 8 260 1 pks13 Polyketide synthase Pks13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P22367 1.22e-06 53 25 12 319 1 None 6-methylsalicylic acid synthase Penicillium patulum
Q54KU3 1.3e-06 53 22 9 298 3 pks25 Probable polyketide synthase 25 Dictyostelium discoideum
N4WHA7 1.33e-06 53 27 10 224 3 PKS2 Reducing polyketide synthase PKS2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q54D44 1.35e-06 53 24 10 274 3 pks42 Probable polyketide synthase 42 Dictyostelium discoideum
A0A0U5GFS8 1.48e-06 53 25 5 206 1 ausA Non-reducing polyketide synthase ausA Aspergillus calidoustus
Q54KU5 1.73e-06 53 22 9 298 3 pks24 Probable polyketide synthase 24 Dictyostelium discoideum
Q869W9 1.82e-06 53 25 8 192 2 pks16 Probable polyketide synthase 16 Dictyostelium discoideum
Q8J0F5 1.83e-06 53 25 15 334 1 mlcB Compactin diketide synthase mlcB Penicillium citrinum
Q0CJ59 2.22e-06 52 22 12 324 1 atX 6-methylsalicylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q54QD3 2.24e-06 52 23 11 269 3 pks22 Probable polyketide synthase 22 Dictyostelium discoideum
A0A0S2CHA9 2.77e-06 52 20 8 296 1 pigA Non-reducing polyketide synthase pigA Monascus ruber
Q54QD1 2.83e-06 52 21 14 327 3 pks23 Probable polyketide synthase 23 Dictyostelium discoideum
Q0D159 2.85e-06 52 25 11 311 2 ATEG_00325 Hybrid PKS-NRPS synthetase ATEG_00325 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A1L7U4V5 2.87e-06 52 27 9 231 2 FMN1 Reducing polyketide synthase 8 Fusarium mangiferae
A0A8D5M692 2.95e-06 52 26 5 199 1 esdpA Non-reducing polyketide synthase esdpA Penicillium shearii
Q4WLD4 3.2e-06 52 32 3 132 1 pyr2 Non-reducing polyketide synthase pyr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A8F4S8Q3 3.2e-06 52 25 5 221 1 gkaA Hybrid PKS-NRPS synthetase gkaA Penicillium citrinum
Q0CZH1 4.05e-06 52 30 9 186 2 pytA Hybrid PKS-NRPS synthetase pytA (Fragment) Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A193PS74 4.25e-06 52 22 9 321 1 stbA Non-reducing polyketide synthase stbA Stachybotrys bisbyi
Q50LG3 4.42e-06 52 26 18 328 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
Q2HBN0 4.73e-06 52 33 5 124 1 cghG Hybrid PKS-NRPS synthetase cghG Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A0A7L8UVC9 4.95e-06 52 26 11 312 3 ffsA Polyketide synthase-nonribosomal peptide synthetase ffsA Aspergillus flavipes
A0A0G0AID6 5.36e-06 52 26 11 302 1 thnA Hybrid PKS-NRPS synthetase thnA Trichoderma harzianum
A0A6J4B487 6.8e-06 51 26 14 337 3 LUC5 Hybrid PKS-NRPS synthetase LUC5 Fusarium sp.
G1XU04 6.85e-06 51 28 5 174 1 AOL_s00215g283 6-methylsalicylic acid synthase AOL_s00215g283 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)
A0A017SEX7 7.16e-06 51 25 16 323 1 fogA Highly reducing polyketide synthase fogA Aspergillus ruber (strain CBS 135680)
A0A1V6NYI6 8.22e-06 51 29 11 244 3 verA Highly reducing polyketide synthase verA Penicillium polonicum
Q4WAY3 1.21e-05 50 28 8 227 1 af370 Fumagillin dodecapentaenoate synthase af370 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A0R8YWJ7 1.54e-05 50 23 8 242 1 mpas Methylphloroacetophenone synthase Cladonia uncialis
A1CLY8 1.67e-05 50 26 14 306 3 ccsA Polyketide synthase-nonribosomal peptide synthetase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
A0A0Y0M151 1.86e-05 50 25 16 323 1 cla2 Highly reducing polyketide synthase cla2 Cladosporium cladosporioides
K3VA96 1.92e-05 50 23 8 312 3 PKS40 Highly reducing polyketide synthase 40 Fusarium pseudograminearum (strain CS3096)
P34731 2.32e-05 49 44 3 78 1 FAS1 Fatty acid synthase subunit beta Candida albicans
Q4WAZ9 2.55e-05 49 27 14 342 2 NRPS14 PKS-NRPS hybrid synthetase psoA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9Y7D5 2.72e-05 49 24 12 313 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus
C5H885 2.76e-05 49 24 15 332 3 rads1 Reducing polyketide synthase rads1 Floropilus chiversii
A0A0U4ZX08 2.93e-05 49 24 9 334 1 drtA Low-reducing polyketide synthase drtA Aspergillus calidoustus
Q0V6Q6 3.04e-05 49 24 10 319 1 phmA Polyketide synthase-nonribosomal peptide synthetase phmA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A2Z5TM64 3.53e-05 49 27 7 245 3 himA Polyketide synthase-nonribosomal peptide synthetase hybrid himA Aspergillus japonicus
A0A0N7D4P6 3.56e-05 49 22 13 339 2 Dhc3 Highly reducing polyketide synthase Dhc3 Alternaria cinerariae
S0DS59 3.66e-05 49 26 13 249 2 PKS-NRPS1 Trichosetin synthetase PKS-NRPS1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q84HC6 4.21e-05 48 27 12 285 1 ncsB Neocarzinostatin naphthoate synthase Streptomyces carzinostaticus
A0A167LUQ4 4.53e-05 48 26 12 318 3 fumoS Fumosorinone synthetase Cordyceps fumosorosea (strain ARSEF 2679)
N4WHE3 4.53e-05 48 24 7 227 3 PKS1 Reducing polyketide synthase PKS1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
A0A4P8WAE5 5.31e-05 48 27 10 237 3 pyiS Polyketide synthase-nonribosomal peptide synthetase pyiS Pyricularia grisea
Q55E72 5.48e-05 48 24 8 183 1 stlA Probable polyketide synthase 1 Dictyostelium discoideum
G3JUI8 6.33e-05 48 25 8 233 1 milA Highly reducing polyketide synthase milA Cordyceps militaris (strain CM01)
A0A0A0RM07 6.56e-05 48 25 10 258 1 MLNS Mellein synthase Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q869X2 6.64e-05 48 25 8 192 3 pks17 Probable polyketide synthase 17 Dictyostelium discoideum
A0A455R5P9 7.34e-05 48 24 7 220 1 ascC Non-reducing polyketide synthase ascC Acremonium egyptiacum
P34229 7.53e-05 48 33 6 166 3 FAS1 Fatty acid synthase subunit beta Yarrowia lipolytica (strain CLIB 122 / E 150)
A0A3G1DJF3 7.78e-05 48 27 11 225 2 pks2 Squalestatin hexaketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
A0A345BJN0 8.57e-05 48 27 10 250 1 clz14 Squalestatin hexaketide synthase clz14 Cochliobolus lunatus
A0A089FSA4 8.93e-05 48 28 10 229 3 prlS Hybrid PKS-NRPS synthetase prlS Fungal sp. (strain NRRL 50135)
Q00706 9.57e-05 47 30 5 139 2 stcK Fatty acid synthase beta subunit stcK Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q558Y6 9.62e-05 47 21 10 265 3 pks14 Probable polyketide synthase 14 Dictyostelium discoideum
B0G103 0.000116 47 20 7 262 3 pks10 Probable polyketide synthase 10 Dictyostelium discoideum
A0A345BJP0 0.000123 47 24 12 306 3 clz2 Squalestatin tetraketide synthase clz2 Cochliobolus lunatus
A0A2Z5XAL7 0.000128 47 30 3 137 1 phm1 Hybrid PKS-NRPS synthetase phm1 Pyrenochaetopsis sp.
A0A443HK66 0.000153 47 28 8 188 3 VdtX Highly reducing polyketide synthase VdtX Byssochlamys spectabilis
K2QYX5 0.000184 47 26 13 299 1 mpsA Hybrid PKS-NRPS synthetase mpsA Macrophomina phaseolina (strain MS6)
A0A455LLX1 0.000196 47 25 15 328 1 atnH Highly reducing polyketide synthase atnH Arthrinium sp.
Q54TW0 0.000216 46 23 7 208 2 pks18 Probable polyketide synthase 18 Dictyostelium discoideum
P0DUK1 0.00026 46 23 10 316 3 pspA Highly reducing polyketide synthase pspA Penicillium soppii
G0REX6 0.000282 46 24 9 306 1 iliA Hybrid PKS-NRPS synthetase iliA Hypocrea jecorina (strain QM6a)
A0A8F4S6Z6 0.000291 46 28 2 135 1 pydA Hybrid PKS-NRPS synthetase pydA Acremonium sp.
J4KMC1 0.000302 46 26 15 348 1 tenS Tenellin synthetase Beauveria bassiana (strain ARSEF 2860)
B4XYB8 0.00031 46 28 10 281 1 aziB 5-methyl-1-naphthoate synthase Streptomyces sahachiroi
G9N4B2 0.000317 46 24 12 319 1 virA Highly reducing polyketide synthase virA Hypocrea virens (strain Gv29-8 / FGSC 10586)
K2QVI8 0.000318 46 25 4 143 1 dpmpA Non-reducing polyketide synthase dpmpA Macrophomina phaseolina (strain MS6)
E9F5E7 0.0004 45 23 9 241 1 subA Non-reducing polyketide synthase subA Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
A0A0U5GK88 0.000594 45 26 8 245 1 ausV Highly reducing polyketide synthase ausV Aspergillus calidoustus
B6QK81 0.000595 45 22 9 299 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN6 0.000595 45 22 9 299 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei
P9WEX6 0.000882 44 23 9 234 1 dpmaA Non-reducing polyketide synthase dpmaA Metarhizium anisopliae
A0JJU1 0.001 44 26 16 348 1 tenS Tenellin synthetase Beauveria bassiana

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_14905
Feature type CDS
Gene fabD
Product ACP S-malonyltransferase
Location 43374 - 44306 (strand: 1)
Length 933 (nucleotides) / 310 (amino acids)
In genomic island -

Contig

Accession ZDB_694
Length 115897 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_350
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00698 Acyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0331 Lipid transport and metabolism (I) I Malonyl CoA-acyl carrier protein transacylase

Kegg Ortholog Annotation(s)

Protein Sequence

MSAYAMVFPGQGSQSVGMLADLAANFPVVEATFAEASAELGYDLWALVQNGPEEELNKTWQTQPALLAASVAIWRVWQEKNGAMPAMMAGHSLGEYSALVCAGVMDFKEAIKLVELRGRLMQEAVPAGTGAMYAIIGLDNDAIARACEEAAQGQIVSPVNFNSPGQVVIAGEKDAVERAGALCKEAGAKRALPLSVSVPSHCALMKPAADKLAVALKNITFNTPIFSVVNNVDVKIETSADAIRDALVRQLYNPVRWTETVEFMAAQGIEDLLEAGPGKVLTGLTKRIVKTLTSSAVNDMSSLETALENR

Flanking regions ( +/- flanking 50bp)

TGCCTGGGGTTCTGCATTAATTCGTTTTTAATTTTTCAGGAAGCTAAATCATGTCTGCATATGCAATGGTATTTCCGGGACAGGGTTCTCAGTCAGTCGGTATGCTGGCGGACCTCGCGGCAAATTTTCCGGTCGTTGAGGCAACCTTTGCCGAAGCATCCGCTGAACTGGGCTACGATTTATGGGCGCTCGTTCAGAACGGACCGGAAGAAGAACTGAATAAAACCTGGCAGACCCAGCCTGCACTGCTGGCGGCCTCTGTGGCCATCTGGCGTGTCTGGCAGGAAAAAAACGGCGCAATGCCTGCCATGATGGCCGGTCACAGCCTGGGAGAATACTCCGCGCTGGTGTGTGCCGGTGTGATGGATTTTAAAGAAGCCATCAAACTGGTGGAATTACGCGGCCGCCTGATGCAGGAAGCCGTTCCGGCCGGTACCGGGGCAATGTATGCCATCATCGGTCTGGACAATGATGCTATCGCCAGAGCCTGTGAAGAAGCTGCACAGGGTCAGATCGTATCACCGGTTAACTTTAACTCGCCGGGCCAGGTGGTTATTGCCGGTGAGAAAGACGCCGTTGAGCGTGCCGGGGCATTATGTAAGGAAGCCGGAGCAAAACGTGCGCTGCCGTTGTCGGTCAGTGTGCCGTCACATTGTGCATTAATGAAGCCGGCTGCTGATAAATTAGCCGTTGCGCTAAAAAATATCACATTTAATACACCAATCTTTTCTGTTGTGAACAATGTTGATGTTAAGATAGAGACTTCCGCCGATGCAATTCGTGATGCATTAGTCCGTCAGCTTTATAATCCGGTGCGCTGGACAGAAACTGTTGAGTTTATGGCCGCGCAGGGTATTGAAGATCTGCTGGAAGCAGGGCCGGGCAAAGTACTGACCGGGCTGACTAAGCGTATTGTGAAAACATTAACATCATCTGCTGTCAATGATATGTCATCATTGGAAACAGCACTTGAAAATCGCTGAGGTTGAGATGAGCTTTGAAGGCAAAATTGCCCTTGTCACCGGTGCGAGCC